Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.069 1.8e+02 4.3 0.0 18 43 25 50 11 55 0.85

2 9 0.0038 9.7 8.3 0.6 21 47 56 81 47 87 0.80

3 9 0.03 77 5.4 0.5 18 43 81 106 80 111 0.82

4 9 0.013 32 6.6 0.0 16 52 107 143 104 143 0.86

5 9 0.064 1.6e+02 4.4 0.2 22 44 141 163 138 167 0.88

6 9 0.028 72 5.5 0.0 21 52 168 199 164 200 0.87

7 9 0.29 7.4e+02 2.3 0.1 22 45 197 220 194 227 0.83

8 9 0.032 80 5.4 0.0 20 45 223 248 212 252 0.85

9 9 0.012 30 6.8 0.1 18 46 249 277 248 283 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.069	1.8e+02	4.3	0.0	18	43	25	50	11	55	0.85
2	9	0.0038	9.7	8.3	0.6	21	47	56	81	47	87	0.80
3	9	0.03	77	5.4	0.5	18	43	81	106	80	111	0.82
4	9	0.013	32	6.6	0.0	16	52	107	143	104	143	0.86
5	9	0.064	1.6e+02	4.4	0.2	22	44	141	163	138	167	0.88
6	9	0.028	72	5.5	0.0	21	52	168	199	164	200	0.87
7	9	0.29	7.4e+02	2.3	0.1	22	45	197	220	194	227	0.83
8	9	0.032	80	5.4	0.0	20	45	223	248	212	252	0.85
9	9	0.012	30	6.8	0.1	18	46	249	277	248	283	0.85

Coding Sequence: ATGGCGAAAAACATAACTGTGATATTTGTGAGAAGGTTTGCTCACCAACAGACTTTAAAAGTCCATTTAAGAAGACATAATGGCGAAAAACCTTATATATGTGATATTTGTGATAAAGGATTTTCTACAGGATATAGTTTAAAAAGGCATACAAGGACACATACTGAGGAAAAaccttataaatgtgatattTGTCATCAAAGGTTTGCTCAGCAACAGACTTTAAAAGTCCATTTAAGAAGACATACTGGCGAAAAACCTTATATATGTGATATTTGTGATATTGTATTTACTCAGCAAAGCACTTTAATATGCCATAGAAGAAAACATAATGGCGAAAAACCTTATATATGTGGTATTTGTGATAAAGGATTTTCTACAGgatcaaatttaaaaacgcATACAAGGTTACATGATGGTAAAAAaccttataaatgtgatattTGTGATGAAAGGTTTTGTCAGCAAAGCAATTTAAAAAGCCATATAAGAAAACATACAGGTGAAAAACCTTATATATGTGATATATGTGATAAGGGATTTTCTACAGgatcaaatttaaaaacgcATACAAGGTTACATGATGGTAAAAAaccttataaatgtgatattTGTCATCAAAGGTTTTGTCAGCAAGGCGCTTTAAAAGGCCATATAAGAAAACATACAGGTGAAAAACCTTATATATGTGATATATGTGATAAGGGATTTTCTACAGGATCAAATTTAAAAGTCCATTTAAGAAGACATACTGGCGAAAAACCTTATATATGTGATATATGTGATAAGGGATTTTGTACAAAATCCAATTTAACAAGACATATAAGGACACATACTGAGGAAAAAccttaa
Protein Sequence: MAKNITVIFVRRFAHQQTLKVHLRRHNGEKPYICDICDKGFSTGYSLKRHTRTHTEEKPYKCDICHQRFAQQQTLKVHLRRHTGEKPYICDICDIVFTQQSTLICHRRKHNGEKPYICGICDKGFSTGSNLKTHTRLHDGKKPYKCDICDERFCQQSNLKSHIRKHTGEKPYICDICDKGFSTGSNLKTHTRLHDGKKPYKCDICHQRFCQQGALKGHIRKHTGEKPYICDICDKGFSTGSNLKVHLRRHTGEKPYICDICDKGFCTKSNLTRHIRTHTEEKP

Sequence clustering based on sequence similarity using MMseqs2