Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 11 0.73 1.9e+03 1.0 0.0 23 44 4 25 2 33 0.84

2 11 0.76 1.9e+03 1.0 0.3 20 31 29 40 22 56 0.78

3 11 0.029 74 5.5 0.0 20 43 57 80 51 84 0.87

4 11 0.022 55 5.9 0.1 15 44 80 109 78 119 0.82

5 11 2.6 6.6e+03 -0.8 0.1 20 31 113 124 108 136 0.80

6 11 0.03 76 5.5 0.0 20 43 169 192 163 196 0.87

7 11 0.021 54 5.9 0.0 15 48 192 225 190 229 0.81

8 11 0.096 2.4e+02 3.8 0.0 21 43 226 248 222 253 0.88

9 11 0.03 75 5.5 0.0 20 43 253 276 247 280 0.87

10 11 0.057 1.5e+02 4.6 0.0 15 43 276 304 274 309 0.86

11 11 0.2 5.1e+02 2.8 0.0 21 43 310 332 302 333 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	11	0.73	1.9e+03	1.0	0.0	23	44	4	25	2	33	0.84
2	11	0.76	1.9e+03	1.0	0.3	20	31	29	40	22	56	0.78
3	11	0.029	74	5.5	0.0	20	43	57	80	51	84	0.87
4	11	0.022	55	5.9	0.1	15	44	80	109	78	119	0.82
5	11	2.6	6.6e+03	-0.8	0.1	20	31	113	124	108	136	0.80
6	11	0.03	76	5.5	0.0	20	43	169	192	163	196	0.87
7	11	0.021	54	5.9	0.0	15	48	192	225	190	229	0.81
8	11	0.096	2.4e+02	3.8	0.0	21	43	226	248	222	253	0.88
9	11	0.03	75	5.5	0.0	20	43	253	276	247	280	0.87
10	11	0.057	1.5e+02	4.6	0.0	15	43	276	304	274	309	0.86
11	11	0.2	5.1e+02	2.8	0.0	21	43	310	332	302	333	0.85

Coding Sequence: ATGGAGAAGAAACCTTACCCATGTGATGTCTGTGACAAGTTGTTCCTTAAAAGTTACAATTTGACGACACATCGACGTACGCACACAGGTGAAAAACCATAcgcatgcgatatatgcgacaagtcgttctctgtaaaTAGCAGATTAATTTCACATCGACGtacgcacactggcgaaaaaccgtacgcgtgcgatgtatgtgacaagtattTCACTCAAAGTGGAGATTTGACAAAACATAGACGcacgcacactggcgaaaaaccgtacgcatgcgatatatgcgacaagtcgttctctgtgagtagcAATTTGATGGCACATCGACgaacgcacactggtgaaaaaccgtacgcatgcgatgtatgcgacaaagCGTTTTCTGTAAATAGCAGTTTAATTGCACATCGACGtacgcacactggcgaaaaactaTACGCTTGCGATGTATGTGATAAGTATTTCACTCAAAATAACCAATTGATGGTACATCGACGcacgcacactggcgaaaaaccgtacgcgtgcgatgtatgtgacaagtattTCACTCAAAGTGGCGATTTGacgaaacatcgacgcacacacactggtgaaaaaccgtacgcctgcgatatatgcgacaagtcattctctGTGAGCGATAGTTTGACGAAACATGTACGCatacacactggtgaaaaaccgtacgcatgtgatatatgcgacaagtcgttctctgtgagtagcAATTTGATGGCACATCGACGcacgcacactggcgaaaaaccgtacgcgtgcgatgtatgtgacaagtattTCACTCAAAGTGGCGATTTGACAAAACATAGACGcacgcacactggcgaaaaaccgtacgcatgcgacgTATGTGACAAGTATTTCACTCGAAGTGGCGATTTGAAAAAACATGGACGcacgcacactggtgaaaaaccgtacgcgtgcgatgtatgtgacaagtattTCACTCGAAGTGGCGATTTGAAACAACATACGTAG
Protein Sequence: MEKKPYPCDVCDKLFLKSYNLTTHRRTHTGEKPYACDICDKSFSVNSRLISHRRTHTGEKPYACDVCDKYFTQSGDLTKHRRTHTGEKPYACDICDKSFSVSSNLMAHRRTHTGEKPYACDVCDKAFSVNSSLIAHRRTHTGEKLYACDVCDKYFTQNNQLMVHRRTHTGEKPYACDVCDKYFTQSGDLTKHRRTHTGEKPYACDICDKSFSVSDSLTKHVRIHTGEKPYACDICDKSFSVSSNLMAHRRTHTGEKPYACDVCDKYFTQSGDLTKHRRTHTGEKPYACDVCDKYFTRSGDLKKHGRTHTGEKPYACDVCDKYFTRSGDLKQHT

Sequence clustering based on sequence similarity using MMseqs2