Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.029 74 5.5 0.0 21 43 47 69 39 78 0.84

2 7 0.28 7.2e+02 2.3 0.1 14 43 96 125 93 130 0.77

3 7 0.018 45 6.2 0.0 21 43 131 153 124 158 0.84

4 7 0.025 64 5.7 0.0 21 48 159 186 152 190 0.84

5 7 0.0015 3.9 9.6 0.0 21 48 187 214 183 218 0.87

6 7 0.014 37 6.5 0.0 21 44 215 238 211 243 0.88

7 7 4.5e-05 0.12 14.5 0.0 21 47 243 269 238 275 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.029	74	5.5	0.0	21	43	47	69	39	78	0.84
2	7	0.28	7.2e+02	2.3	0.1	14	43	96	125	93	130	0.77
3	7	0.018	45	6.2	0.0	21	43	131	153	124	158	0.84
4	7	0.025	64	5.7	0.0	21	48	159	186	152	190	0.84
5	7	0.0015	3.9	9.6	0.0	21	48	187	214	183	218	0.87
6	7	0.014	37	6.5	0.0	21	44	215	238	211	243	0.88
7	7	4.5e-05	0.12	14.5	0.0	21	47	243	269	238	275	0.85

Coding Sequence: ATGGAGAAGGAATATTTTCCGAGTAATGTCTTGACTATATGTCAActccgtaaaaaaaaaaaactgtatgaaTGTGATGTTTGCGACAAGTCATTCTCCTTAAGTTGCAGTTTGACGGCACACAAACGAACGCACAGTGGAGAAAAACCATTCTTGTGCGATATATGTGACAAGCCGTTCTCTCAAAGTAACTATTTGACAAAACATCGACGTACGCACAATGGAGAAAAAACATTCTTGTGCGATATATGTGACATGCCGTTCTCTCTAAGTAACTATTTGACAAAACATCGACGTACGCACAATGGAGAAAAACCATTCGCGTGCGATGTATGCGAAAAGTCTTTCTCTGTAAGTAGTAGTTTGGCTGCACACTACCGAACTCACACTGGAGAAAAACCATTCACGTGCGATATATGTGACAAGTTGTTCTCTCAACGTAGTAGTTTGGCTGAACACAAGCGAACGCACACTGGAGAAAAACCATTCGCGTGCGATTTATGTGACAAGACGTTCTCTCAAAGTGGTAGTTTGACGGTACACATGAGAatacatactggagaaaaaccatTCTCGTGCTATATTTGCGACAAGACGTTCTCTGTAAGTGGCAATTTGAGGGTACACATGAGAATACACACTGGAGAAAAACCATTCGCGTGCGATATATGTGACAAGTTGTTCTCTCAAAGTAGTAGTTTGGCTGCACACAAGCGAATGCACACTGGAGAAAAACCATTCTCGTGCAATATATGCTACAAGACATTCTCTTTAAGTGGCAATTTGAGGGCGCACAAGAGAATACacactggagaaaaaccgtttGCAAATTGA
Protein Sequence: MEKEYFPSNVLTICQLRKKKKLYECDVCDKSFSLSCSLTAHKRTHSGEKPFLCDICDKPFSQSNYLTKHRRTHNGEKTFLCDICDMPFSLSNYLTKHRRTHNGEKPFACDVCEKSFSVSSSLAAHYRTHTGEKPFTCDICDKLFSQRSSLAEHKRTHTGEKPFACDLCDKTFSQSGSLTVHMRIHTGEKPFSCYICDKTFSVSGNLRVHMRIHTGEKPFACDICDKLFSQSSSLAAHKRMHTGEKPFSCNICYKTFSLSGNLRAHKRIHTGEKPFAN

Sequence clustering based on sequence similarity using MMseqs2