Basic Information

Gene Symbol
-
Assembly
GCA_949089665.1
Location
CARXXK010000002.1:85964174-85966201[-]

Transcription Factor Domain

TF Family
zf-GAGA
Domain
zf-GAGA domain
PFAM
PF09237
TF Group
Zinc-Coordinating Group
Description
Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 14 0.9 2.3e+03 0.7 0.0 26 43 7 24 2 34 0.83
2 14 1.7 4.3e+03 -0.1 0.1 21 41 30 50 24 61 0.76
3 14 0.015 39 6.4 0.3 21 43 103 125 76 130 0.91
4 14 0.019 48 6.1 0.0 16 44 126 154 124 163 0.83
5 14 0.046 1.2e+02 4.9 0.0 22 43 160 181 153 186 0.88
6 14 0.016 41 6.3 0.1 22 43 188 209 181 213 0.89
7 14 0.004 10 8.3 0.0 15 44 209 238 207 247 0.83
8 14 1.3 3.3e+03 0.2 0.0 22 43 244 265 238 269 0.86
9 14 0.0078 20 7.3 0.0 20 44 270 294 262 302 0.84
10 14 0.012 29 6.8 0.0 22 44 300 322 293 330 0.86
11 14 0.35 8.9e+02 2.0 0.1 15 43 321 349 319 360 0.78
12 14 0.75 1.9e+03 1.0 0.0 21 44 355 378 346 386 0.82
13 14 0.26 6.5e+02 2.5 0.0 20 43 382 405 372 411 0.84
14 14 0.00063 1.6 10.8 0.1 20 47 410 437 403 444 0.83

Sequence Information

Coding Sequence
ATGGAACAGAACTCTTACCCATGCGATGTCTGTGACAAGTCATTCAGCCAAAGTAGCAATTTGACGATACACAAACGAACCAATACTGGCGAAAAACCCTATGcctgcgatgtatgtgacaaaccCTTCAGCCAAAATGCCAGTTTAACGATACACAAACGaacacacactggcgaaaaaccgtacgcatgggatgtatgtgacaagtcttTCAGTCAAAATATCCATTTGACAAAACATCGACGCACaaatactggagaaaaaccgtacgcatgcgatgtatgtgacgaGTCGTTCGCTGAAAGAGGTGACAAaccctacgcatgcgatgtatgtgacaaatccttcagccaaagtaccaatttaacgaaacatcgacgcacacatactggagaaaaaccgtacgcatgcgatgtatgtgacaagtccttcagccaaagtaccagtttaacgaaacatcaacgtacacacacaggtgacaaaccctacgcatgcgatgtatgtgacaaatccttcagccaaagtaccaatttaacggatcatcaacgtacacacacaggtgacaaaccctacgcatgcgatgtatgtgacaaatccttcagccaaagtaccaatttaacgaaacatcgacgcacacatactggagaaaaaccgtacgcatgcgatgtatgtgacaaatccttcagccaaagtaccaatttaacggatcatcaacgtacacacacaggtgacaaaccctacgcatgcgatgtatgtgacaagtcttTCAGTCAAAATACTAGTTTGACAAAACATcaacgcacacatactggagaaaaaccgtacgcatgcgatgtatgtgacaaatccttcagccaaagtaccaatttaacggatcatcaacgtacacacacaggtgacaaaccctacgcatgcgatgtatgtgacaaatccttcagccaaagtaccaatttaacgaaacatcgacgcacacatactggagaaaaaccgtacgcatgcgatgtatgtgacaaatccttcagccgAAGTACCAGTTTAACGGATCATCAACGTACACACACAGGTGACAAaccctacgcatgcgatgtatgtgacaagtcttTCAGTCAAAATACCAGTTTGACAAAACATcaacgcacacatactggagaaaaaccgtacgcatgcgatgtatgtgacaagtcttTCAGTCAAAATTCCAGTTTGACAAAACATcaacgcacacatactggagaaaaaccgtacgcatgtgatgtatgtgacaaatccttcagccaaagtaccaGTTTAACGAGACATCTACGTACACACACAGGTGACAAACCCTACGCATGCGATGAATGTGACAAGACATTCTCTGTAAGTGGCAATTTGGTGGCACACAAGCGGAAGCACAAGGAACACTGA
Protein Sequence
MEQNSYPCDVCDKSFSQSSNLTIHKRTNTGEKPYACDVCDKPFSQNASLTIHKRTHTGEKPYAWDVCDKSFSQNIHLTKHRRTNTGEKPYACDVCDESFAERGDKPYACDVCDKSFSQSTNLTKHRRTHTGEKPYACDVCDKSFSQSTSLTKHQRTHTGDKPYACDVCDKSFSQSTNLTDHQRTHTGDKPYACDVCDKSFSQSTNLTKHRRTHTGEKPYACDVCDKSFSQSTNLTDHQRTHTGDKPYACDVCDKSFSQNTSLTKHQRTHTGEKPYACDVCDKSFSQSTNLTDHQRTHTGDKPYACDVCDKSFSQSTNLTKHRRTHTGEKPYACDVCDKSFSRSTSLTDHQRTHTGDKPYACDVCDKSFSQNTSLTKHQRTHTGEKPYACDVCDKSFSQNSSLTKHQRTHTGEKPYACDVCDKSFSQSTSLTRHLRTHTGDKPYACDECDKTFSVSGNLVAHKRKHKEH

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00941990;
90% Identity
iTF_00941990;
80% Identity
iTF_00941990;