Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0048 41 5.6 0.2 24 47 91 114 85 119 0.82

2 6 0.026 2.2e+02 3.3 0.1 21 35 116 130 113 142 0.78

3 6 5.8e-06 0.05 14.9 0.0 21 52 144 175 138 177 0.89

4 6 4.9e-05 0.42 12.0 0.2 22 48 173 199 170 203 0.85

5 6 0.019 1.6e+02 3.7 0.6 21 44 200 223 196 233 0.73

6 6 0.53 4.5e+03 -0.9 0.1 20 30 227 237 216 239 0.76

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0048	41	5.6	0.2	24	47	91	114	85	119	0.82
2	6	0.026	2.2e+02	3.3	0.1	21	35	116	130	113	142	0.78
3	6	5.8e-06	0.05	14.9	0.0	21	52	144	175	138	177	0.89
4	6	4.9e-05	0.42	12.0	0.2	22	48	173	199	170	203	0.85
5	6	0.019	1.6e+02	3.7	0.6	21	44	200	223	196	233	0.73
6	6	0.53	4.5e+03	-0.9	0.1	20	30	227	237	216	239	0.76

Coding Sequence: atgaatattagaGGTTCGGAAGGCATAGAAGTGAAGAAACCTATGAATATCAAAGAAGAACCTGACACTGAACATAAATATAACCACGCTGACATTAAAGAGtgtgtatttataaaatatgaagtTCAAGACGGTACAAAAGACACGAAATGCAAATTTGAAGAATTACCTCAATCCTCCCTTAACATCAAAGAAGAAAGTGCATCCATTGCATCGTCAAAAACAGCACTCCAAATTCTAATCTCAGAAATTACAAGGAAAGATAAACCACCGTTTGTATGTAAACGCTGTAATTCGACATTTACACGAAAAGCGAATTTGAAAAGACACTTGCTAATTCACACGGGTGAAAAACCGTACGACTGCAGTATTTGTCACGCAAAATTTAGCGAAAAATCAAAGGTAAAAATTCACCAAACAATTCACACTGGCGAAAAGCCATTCGCATGCGGTGTTTGCGATGCAAAATTCAGACAGAAATCAACCCTTAAAAAACATTTACGAATCCATACCGGCGATAAACCTTACTTGTGTCGCATATGTGACTCGAGATTTGCTCAAACCTCAAATTTGCAAAGGCATTTAAAATGGCATGCGAATGAAAAACCTTATGCGTGTGAAATTTGTAGTTACAAATGCATCGAGAAGAAACGCATGAAGATTCATTTAAGAAGCCACACGGGTGAGAAACCTTACGCGTGCGAAATGTGCGATTATAAATCTTCGGGAGAGAAAATTTGA
Protein Sequence: MNIRGSEGIEVKKPMNIKEEPDTEHKYNHADIKECVFIKYEVQDGTKDTKCKFEELPQSSLNIKEESASIASSKTALQILISEITRKDKPPFVCKRCNSTFTRKANLKRHLLIHTGEKPYDCSICHAKFSEKSKVKIHQTIHTGEKPFACGVCDAKFRQKSTLKKHLRIHTGDKPYLCRICDSRFAQTSNLQRHLKWHANEKPYACEICSYKCIEKKRMKIHLRSHTGEKPYACEMCDYKSSGEKI

Sequence clustering based on sequence similarity using MMseqs2