Lyun036092.1
Basic Information
- Insect
- Lycocerus yunnanus
- Gene Symbol
- -
- Assembly
- GCA_036346125.1
- Location
- JARFIX010000286.1:76211-77002[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 8 0.26 2.3e+03 0.0 0.1 21 30 5 14 3 32 0.84 2 8 0.12 1e+03 1.2 0.3 21 31 34 45 29 60 0.76 3 8 0.00031 2.7 9.4 0.0 21 51 62 92 58 94 0.85 4 8 0.015 1.3e+02 4.0 0.0 21 46 90 115 87 117 0.87 5 8 0.0034 30 6.1 0.0 21 47 118 144 115 151 0.85 6 8 0.19 1.6e+03 0.5 0.0 22 47 176 201 171 206 0.75 7 8 0.0084 72 4.8 0.0 21 47 203 229 199 234 0.82 8 8 0.00037 3.2 9.2 0.2 21 51 231 261 227 263 0.87
Sequence Information
- Coding Sequence
- ATGCTTCATTCAGGCGAAAAAccatttgcatgtgaaatttgtgattttaaattcttttgtaaAGCATATTTAAAAGATCATATTTTAAGAATTCATTCTGGCGAAAAGCCGTTTGCATGCaatatttgtgactacaaatctTGTAAACGATCAGCTTTAGAAGTTCACGTAAGGATTCATACTGGTGAAAAACCTtttacatgtgaaatttgcgCCTCTAAATTTTCAAGATTGGGAGATTTAAACCGCCATTTAATGATCCATTCGGGTGAGAAACCCTTTGCATGTGCAGATTGCGactacaaaactttaaaatcagGAGATTTAAAACGTCATTTAATGATGCACGCAGGCGAAAAGCCCTTTGCATGTgaattttgtgactataaaGCTTTAAAATCGGGGGATTTGAAACGTCATTTAATGATTCACACGCACGAGAAATCCTTTGCGTGTGATATTTGTGACagtaaatttttgtgtaaagcATATTTAAAAGACCACTTTTTAAGGATTCATACTTACGAGAAGCCCTTTGCCTGTGAAAATTGTGACTATAAAACTTCCAAGCAATCGGCTTTAAAAGTTCACTTAAGGATCCATACAGGCGAAAAGCCCTATTCCTGTGAAATATGTAACTTTAAGTTTTCAAGATTAGGAGATTTAAAACGGCATGTAATGATTCACTCGGGAGAAAAACCCTTTGCCTGCGAAAATTGTAACTATAAAGCTTCAacgataagaaatttaaaacgtcaTTTGGCAGTTCATGCTCTgagtaaaaaatcataa
- Protein Sequence
- MLHSGEKPFACEICDFKFFCKAYLKDHILRIHSGEKPFACNICDYKSCKRSALEVHVRIHTGEKPFTCEICASKFSRLGDLNRHLMIHSGEKPFACADCDYKTLKSGDLKRHLMMHAGEKPFACEFCDYKALKSGDLKRHLMIHTHEKSFACDICDSKFLCKAYLKDHFLRIHTYEKPFACENCDYKTSKQSALKVHLRIHTGEKPYSCEICNFKFSRLGDLKRHVMIHSGEKPFACENCNYKASTIRNLKRHLAVHALSKKS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00928056;
- 90% Identity
- iTF_00928056;
- 80% Identity
- iTF_00928056;