Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.11 9.5e+02 1.2 0.0 21 46 6 31 3 33 0.85

2 6 3e-05 0.26 12.7 0.1 21 46 34 59 30 65 0.86

3 6 0.00019 1.6 10.1 0.1 22 52 63 93 58 94 0.86

4 6 0.019 1.6e+02 3.7 0.1 21 44 90 113 86 117 0.81

5 6 2.1e-05 0.18 13.1 0.1 21 47 118 144 112 150 0.86

6 6 0.3 2.6e+03 -0.1 0.1 21 44 146 169 142 172 0.71

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.11	9.5e+02	1.2	0.0	21	46	6	31	3	33	0.85
2	6	3e-05	0.26	12.7	0.1	21	46	34	59	30	65	0.86
3	6	0.00019	1.6	10.1	0.1	22	52	63	93	58	94	0.86
4	6	0.019	1.6e+02	3.7	0.1	21	44	90	113	86	117	0.81
5	6	2.1e-05	0.18	13.1	0.1	21	47	118	144	112	150	0.86
6	6	0.3	2.6e+03	-0.1	0.1	21	44	146	169	142	172	0.71

Coding Sequence: ATGAAAAATCATACGGGCGAGAAGCCGTTCGAGTGTGGATTATGTGACTATAAGTGTTCATACAGCAccggtttaaaaattcatttaagaattcatacgggcgagaagccgtttacctgtgaaatttgtggatACAAATGTTCGCAGGATAGTGCTCTGAGGAAACATTTAAGAACGCATACTGGTGATAAACCTTTTATATGccaattttgtgattataaatgtagaGAAAGCGGcgatttaaaaagacatttaagaattcacactggtgagaagccGTTTACGTGTGATTTATGTGACTACAAGGGTGCACAAAGAGCAGCTCTGAAGATTCACTTGAGAACCCATACAGGCGAGAAGCCGTTTACATGCgaaatttgtaactacaaatCTACGCAGAAAGGAAATATTCgaaatcatttaagaactcataccggcgagaaaccgtttaaatgtgaattttgtaattataaatgtgtAGAAAAGGGTAGTTTAAAGAAACATATAAGAATTCATATCGGaatttaa
Protein Sequence: MKNHTGEKPFECGLCDYKCSYSTGLKIHLRIHTGEKPFTCEICGYKCSQDSALRKHLRTHTGDKPFICQFCDYKCRESGDLKRHLRIHTGEKPFTCDLCDYKGAQRAALKIHLRTHTGEKPFTCEICNYKSTQKGNIRNHLRTHTGEKPFKCEFCNYKCVEKGSLKKHIRIHIGI

Sequence clustering based on sequence similarity using MMseqs2