Lnic008555.1
Basic Information
- Insect
- Luperina nickerlii
- Gene Symbol
- Bgb_2
- Assembly
- GCA_963855955.1
- Location
- OY979667.1:12466393-12466719[-]
Transcription Factor Domain
- TF Family
- CBF
- Domain
- CBF_beta domain
- PFAM
- PF02312
- TF Group
- Beta-Scaffold Factors
- Description
- Core binding factor (CBF) is a heterodimeric transcription factor essential for genetic regulation of hematopoiesis and osteogenesis. The beta subunit enhances DNA-binding ability of the alpha subunit in vitro, and has been show to have a structure related to the OB fold [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 9.8e-30 2.1e-25 90.5 0.4 102 164 1 63 1 66 0.97
Sequence Information
- Coding Sequence
- ATGAACGGCGTGTGCGTGAGGTGGCGGGGCTGGATTGACTTGGAGCGGCTCGACGGCGTCGGCTGTTTGGAACTGGACGAGGAGCGAGCAGCTATCGAGGACGCGGCGCTGCGCGACCAGATCGAGCGGTACAACCAGCGCCTGCGCGACTTCGAGGACAAGCAGCGCGCGTACCGCGAGCACGGCGAGGAGCTGCGCGCGCACGCGCACGTGCACCAGCGCTGCCACCAGCCGCGCCAGCCGCCACACGCCGCGCACCCCGCGCACCCGCACCCGCCGCACCCAGGCCACATCAAGCCGCACTCGCAGGGCGCGCTCATCTCATAG
- Protein Sequence
- MNGVCVRWRGWIDLERLDGVGCLELDEERAAIEDAALRDQIERYNQRLRDFEDKQRAYREHGEELRAHAHVHQRCHQPRQPPHAAHPAHPHPPHPGHIKPHSQGALIS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00795460;
- 90% Identity
- iTF_00420302;
- 80% Identity
- -