Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0025 59 3.8 2.0 11 16 13 18 11 20 0.83

2 4 0.021 5e+02 0.8 0.4 12 15 33 36 32 42 0.86

3 4 4e-10 9.5e-06 25.5 2.2 4 21 52 69 50 70 0.87

4 4 0.22 5.2e+03 -2.4 3.9 12 15 86 89 85 90 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0025	59	3.8	2.0	11	16	13	18	11	20	0.83
2	4	0.021	5e+02	0.8	0.4	12	15	33	36	32	42	0.86
3	4	4e-10	9.5e-06	25.5	2.2	4	21	52	69	50	70	0.87
4	4	0.22	5.2e+03	-2.4	3.9	12	15	86	89	85	90	0.86

Coding Sequence: ATGTCTGATGATGGATCAACTGTAGTAGAGAAAAAGGGACGGGGAAGGCCAAAATCAAACGGCACTCAATCGGAAGCCAAAGCTGATGCCAAGAAACGTGGAAGACCACCAGTGGCTAAAACAAAAGAGGCGGCAAAATCATCTGATGATGAACAGGCACCAGTAGCAAAACGAGGCAGAGGCAGACCTAAGGGATCTAAGAAGAAGGCGCCTGCCAAGAAGAGTGGTGGTGGATCTGAAAGCAGGGGTGTGGGACGTGGGCGGCCGCGCAAAGAAGCACCTCCAAAAAAAGATGCCGCTTCAACTGAGGAGGAACAGGACGAGGATGAAGAAGATGAGGGCTCTGACCAGTAA
Protein Sequence: MSDDGSTVVEKKGRGRPKSNGTQSEAKADAKKRGRPPVAKTKEAAKSSDDEQAPVAKRGRGRPKGSKKKAPAKKSGGGSESRGVGRGRPRKEAPPKKDAASTEEEQDEDEEDEGSDQ

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00818358; iTF_00635422; iTF_00935743; iTF_00432217; iTF_00433168; iTF_01282307; iTF_00075556; iTF_00076550; iTF_01279270; iTF_01281358; iTF_00658417; iTF_01280309; iTF_00074526;
90% Identity: iTF_00635422;
80% Identity: -