Basic Information

Transcription Factor Domain

TF Family: E2F
Domain: E2F_TDP domain
PFAM: PF02319
TF Group: Helix-turn-helix
Description: This family contains the transcription factor E2F and its dimerisation partners TDP1 and TDP2, which stimulate E2F-dependent transcription. E2F binds to DNA as a homodimer or as a heterodimer in association with TDP1/2, the heterodimer having increased binding efficiency. The crystal structure of an E2F4-DP2-DNA complex shows that the DNA-binding domains of the E2F and DP proteins both have a fold related to the winged-helix DNA-binding motif. Recognition of the central c/gGCGCg/c sequence of the consensus DNA-binding site is symmetric, and amino acids that contact these bases are conserved among all known E2F and DP proteins.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.2 9.6e+02 -0.0 0.0 29 48 24 42 9 47 0.60

2 4 0.00029 1.4 9.1 0.1 27 51 48 72 36 80 0.87

3 4 0.00041 1.9 8.6 0.5 27 51 88 111 73 118 0.72

4 4 0.00056 2.6 8.2 1.2 25 48 152 174 109 178 0.79

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.2	9.6e+02	-0.0	0.0	29	48	24	42	9	47	0.60
2	4	0.00029	1.4	9.1	0.1	27	51	48	72	36	80	0.87
3	4	0.00041	1.9	8.6	0.5	27	51	88	111	73	118	0.72
4	4	0.00056	2.6	8.2	1.2	25	48	152	174	109	178	0.79

Coding Sequence: ATGCAAGCAATGCATTGCATGCATTTCCCCCTAGCGAGGAGCGACGAGCGCGTCAAGCATGCTTATGAAATTGCCAAGATACTGCAGCGCGTCAAGCATGCTTATGAAATTGCCAAGATACTGCAGCGCGTCAAGCATGCTTATGAAATTGCCGAGATACTGCAGCAGCGCGTCAAGCATGTTTATGAAATTGCCGAGATACTACAGTGCGTCAAGCATGCTTATGGAATTGCCAAGGTACTGCAGCGCGTCAAGCATGTTTATGAAATTGCCGAGATACTGCAGTGCGTCAAGCGTGTTTATGAAATTGCCGATATACTGCAGCGCGTCAAGCATGCTTATAAAATTGCCGAGATACTGCAGCAGCGCGTCAAGCATGTTTTTGAAATTGCCGAGATACTACCGTGCGTCAAGCATGTTTATGGAATTGCCAAGATACTGCAGCGCGTCAAACATTTATATGAAATTGCCGAGATACTGCAGTGCGTCAAGCGTGTTTATGAAATTGCCGATATACTGCAGCGCGTCAAGCATGCTTAA
Protein Sequence: MQAMHCMHFPLARSDERVKHAYEIAKILQRVKHAYEIAKILQRVKHAYEIAEILQQRVKHVYEIAEILQCVKHAYGIAKVLQRVKHVYEIAEILQCVKRVYEIADILQRVKHAYKIAEILQQRVKHVFEIAEILPCVKHVYGIAKILQRVKHLYEIAEILQCVKRVYEIADILQRVKHA

Sequence clustering based on sequence similarity using MMseqs2