Basic Information

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 1 1.3e-26 2.1e-23 82.5 15.6 1 69 92 160 92 161 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	1	1.3e-26	2.1e-23	82.5	15.6	1	69	92	160	92	161	0.98

Coding Sequence: ATGTATCAGTACAATGAAGAATTACATGATGTCAAAGGCCAGGGCCAGCCTCCGCCATACACACACACCGACCCACCTCAAGTCATGCGCCCAACAAATAATATGTCAATGCAAACGGGACAACCAATATTAGTACCAGTGGGACAACCCATGCATGGAGCAATGGGACAAACCATTCCTATACAACATGGCACAATGATGCATCCCACAGGAGGGATGTACCATGCGCATACCCCGGTCGTCGTGCCCATGGTCGTCGGTAATCAGATGGGCCCTAAACCACAACACATAACCTGCCAATCCTGCAAAGAGGTTATAGTCACAAGAATTGAAGCCAAAGCTACCACAAAGACTCATATGTTTGCAGCCATACTTTGTTTTATGTGTTGTCTGCCATGCGTGTTCATGCCCTACTGTATGGACAGTTGCCGCAATGCTGACCACTACTGTCCAAACTGCAGCGCTTACATCGGCAGCTACGTCCACTAA
Protein Sequence: MYQYNEELHDVKGQGQPPPYTHTDPPQVMRPTNNMSMQTGQPILVPVGQPMHGAMGQTIPIQHGTMMHPTGGMYHAHTPVVVPMVVGNQMGPKPQHITCQSCKEVIVTRIEAKATTKTHMFAAILCFMCCLPCVFMPYCMDSCRNADHYCPNCSAYIGSYVH

Sequence clustering based on sequence similarity using MMseqs2