Llea011878.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Lithophane leautieri
Gene Symbol
bs
Assembly
GCA_949152455.1
Location
OX424469.1:2920236-2921061[-]

Transcription Factor Domain

TF Family
SRF
Domain
SRF domain
PFAM
PF00319
TF Group
Helix-turn-helix
Description
Serum response factor (SRF) is a ubiquitous nuclear protein important for cell proliferation and differentiation. SRF function is essential for transcriptional regulation of numerous growth-factor-inducible genes, such as c-fos oncogene and muscle-specific actin genes. A core domain of around 90 amino acids is sufficient for the activities of DNA-binding, dimerisation and interaction with accessory factors. Within the core is a DNA-binding region, designated the MADS box [2], that is highly similar to many eukaryotic regulatory proteins: among these are MCM1, the regulator of cell type-specific genes in fission yeast; DSRF, a Drosophila trachea development factor; the MEF2 family of myocyte-specific enhancer factors; and the Agamous and Deficiens families of plant homeotic proteins. In SRF, the MADS box has been shown to be involved in DNA-binding and dimerisation [1]. Proteins belonging to the MADS family function as dimers, the primary DNA-binding element of which is an anti-parallel coiled coil of two amphipathic α-helices, one from each subunit. The DNA wraps around the coiled coil allowing the basic N-termini of the helices to fit into the DNA major groove. The chain extending from the helix N-termini reaches over the DNA backbone and penetrates into the minor groove. A 4-stranded, anti-parallel β-sheet packs against the coiled-coil face opposite the DNA and is the central element of the dimerisation interface. The MADS-box domain is commonly found associated with K-box region see (IPR002487).
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 8.7e-11 6.4e-07 29.4 0.1 23 48 53 78 52 78 0.98

Sequence Information

Coding Sequence
ATGGgacaacaaacaaaacatttccAAAAAGTAGCGTTATTGAAATGGTCTAGAAAGTTTCAAGCCTTGCGCATAGCTTTGGATTTAGGACCGTCCGAGAATTTAGATTTTCTAAATGCTTCTAGCCTGCTTGGAGGagattttgtaaaacattttGCATACGAGCTGTCAACCCTGACGGGGACACAAGTGATGTTGCTAGTCGCGTCAGAGACAGGCCACGTATACACGTTCGCGACGCGGAAGCTGCAGCCCATGATCACGTCAGACTCCGGCAAGCGGCTGATCCAGACGTGCCTCAACTCCCCCGATCCTCCTACCACCAGCGAGCAGCGCATGGCCGCGACGGGCTACGAGGAAACAGAGCTCACGTATAACGTAGTAGACGAGGATATGAAGGTGAGGCAATTGGCGTACGCGGGCTCCGCGCAGTACCCGCTAGAACACCACCCCGGGCTGGCGCCGTCGCCGCTTCAGCAGTACCACCAGCACCCCCCCTGCCCCTCGCCGCTACCCCTCAGCTCCCTCGGACAGCCGTACTCGCACGCTCACCTCTCACATCCCCACATGTCGCATCACCCACAACGGTAG
Protein Sequence
MGQQTKHFQKVALLKWSRKFQALRIALDLGPSENLDFLNASSLLGGDFVKHFAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMITSDSGKRLIQTCLNSPDPPTTSEQRMAATGYEETELTYNVVDEDMKVRQLAYAGSAQYPLEHHPGLAPSPLQQYHQHPPCPSPLPLSSLGQPYSHAHLSHPHMSHHPQR

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00711843; iTF_00301154; iTF_00723042; iTF_00726338; iTF_00850722; iTF_00187139; iTF_01094019; iTF_01437027; iTF_00774468; iTF_00783460; iTF_01091908; iTF_00172933; iTF_00710181; iTF_00758149; iTF_00404902; iTF_00871270; iTF_01538726; iTF_00302087; iTF_00364007; iTF_00445159; iTF_00274408; iTF_00185289; iTF_01157769; iTF_00685418; iTF_01152138; iTF_00778731; iTF_00928683; iTF_01027307; iTF_00186156; iTF_00683340; iTF_01452300; iTF_00390349; iTF_00878829; iTF_01156429; iTF_00273582; iTF_00745678; iTF_01367886; iTF_01506318; iTF_00147439; iTF_01018543; iTF_01285519; iTF_01362415; iTF_01525999; iTF_00121424; iTF_00356176; iTF_01221552; iTF_00786769; iTF_01338737; iTF_01028274; iTF_00042611; iTF_00374099; iTF_00432179; iTF_01246963; iTF_01264595; iTF_00657173; iTF_00924661; iTF_01093077; iTF_00171734; iTF_00907862; iTF_00779479; iTF_01533911; iTF_00782616; iTF_00656122; iTF_00858523; iTF_00123356; iTF_00206972; iTF_00622812; iTF_00677596; iTF_00775228; iTF_01062780; iTF_00040797; iTF_00197341; iTF_00775997; iTF_00777981; iTF_00634462; iTF_00809118; iTF_00355135; iTF_00785183; iTF_01029247; iTF_00018144; iTF_00951814; iTF_00055393; iTF_00973762; iTF_00037795; iTF_01533028; iTF_00300197; iTF_01436069; iTF_00250439; iTF_01117192; iTF_00120490; iTF_00913587; iTF_00907028; iTF_01094900; iTF_00888247; iTF_01073592; iTF_00621977; iTF_01158939; iTF_01075421; iTF_00449086; iTF_01030206; iTF_00935705; iTF_01534810; iTF_00261844;
90% Identity
iTF_00758149;
80% Identity
-