Basic Information

Insect: Liometoxenus newtonarum
Gene Symbol: -
Assembly: GCA_030264535.1
Location: JARJEB010028658.1:8568-9401[-]

Transcription Factor Domain

TF Family: HMG
Domain: HMG_box domain
PFAM: PF00505
TF Group: Other Alpha-Helix Group
Description: High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 7.7 6.3e+03 -2.0 0.4 13 22 2 11 1 18 0.63

2 4 1.6e-16 1.3e-13 51.5 0.9 1 68 25 92 25 93 0.98

3 4 0.29 2.3e+02 2.6 0.8 51 65 104 118 95 121 0.84

4 4 8.3e-08 6.8e-05 23.6 3.4 1 69 130 193 130 193 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	7.7	6.3e+03	-2.0	0.4	13	22	2	11	1	18	0.63
2	4	1.6e-16	1.3e-13	51.5	0.9	1	68	25	92	25	93	0.98
3	4	0.29	2.3e+02	2.6	0.8	51	65	104	118	95	121	0.84
4	4	8.3e-08	6.8e-05	23.6	3.4	1	69	130	193	130	193	0.91

Sequence Information

Coding Sequence: ATGAAGCATCAACACGCCAAGCTTAAGCAGAAAGCCAAGGAGAAGCTGAAGGACCTCCACATCCCCGTCCGACCGAAGAAGCCCCTGTCGTCGTTCTTCCGCTTCCTACAAGATTTCCGCGTGGATTTCCTAAAGAGGAATCCGCAGTCGAGGGTGACGGAAATCGTCAAGCACGGCGCTCAGGATTGGGCGAGGGCCCACAGCAGCCTTAAGGAGAGGTACACGCAGGAGTACCGGCACGACATGCAGGACTACAATAAGAAGATCCTCAAGTATTCGTCGAAGCTGACTCCCCTGCAGAAGGAGACCATCAAGGCGTTTCAGAAGGAGAAACAGGAGCATAAGAAGAAGCGTGACTTCAAAAAGAAACTGCGAGCCAGCGACAGACCAAAGCGTCCAATTGGTCCGTACATGCAATTCCTGTTGGAGAAATCGAAGCAATCCAACAAGAAGATGGTGGAGCTGATGCATGACATGAAAGTGCCATGGCGCTCAATGACAGATCACCAGAAGCATCGCTACGTGGCACTCTACGAAGCCGATAGGAGGCGCTATGATGTGGAAATGGCCGAATGGGAGCAACGCATGATCGCTGAAGGCAACACGGACATCGTGCGTAATGCAGGCCATACCAGAAAGCCTACTCGCGTGAGCAAAGTGGGCAAGCATAAGAGAAAACGCTAG
Protein Sequence: MKHQHAKLKQKAKEKLKDLHIPVRPKKPLSSFFRFLQDFRVDFLKRNPQSRVTEIVKHGAQDWARAHSSLKERYTQEYRHDMQDYNKKILKYSSKLTPLQKETIKAFQKEKQEHKKKRDFKKKLRASDRPKRPIGPYMQFLLEKSKQSNKKMVELMHDMKVPWRSMTDHQKHRYVALYEADRRRYDVEMAEWEQRMIAEGNTDIVRNAGHTRKPTRVSKVGKHKRKR

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -