Basic Information

Transcription Factor Domain

TF Family: PC4
Domain: PC4 domain
PFAM: PF02229
TF Group: Unclassified Structure
Description: This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.013 1.4e+02 1.4 0.0 29 37 16 24 8 24 0.84

2 3 1 1.1e+04 -5.6 3.0 28 38 30 40 29 43 0.59

3 3 3.3e-28 3.6e-24 83.3 0.5 1 51 59 110 59 111 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.013	1.4e+02	1.4	0.0	29	37	16	24	8	24	0.84
2	3	1	1.1e+04	-5.6	3.0	28	38	30	40	29	43	0.59
3	3	3.3e-28	3.6e-24	83.3	0.5	1	51	59	110	59	111	0.97

Coding Sequence: ATGCCAAAATCGAAAGAATACATATCTGATAGTGATGATAGCAGTGAGGAGGAGTTAAAACCAACTAAAAAGAAgcagaaaaaggaaaaggatGAAAAGGAAGACAAGGGAGACAAGGGAGACAAAGGAGCGTCacataaaaaagtgaaatcaGACGATGTAGAAGAAACCATCTGGGATTTAGGCAACAATCGCCAAGTAAACGTGAGGAATTTCAAAGGAAAATATTATGTAGATATTCGAGAAATGTATTACGACAAAGAAGGCGATTTAAAACCTGGGAAAAAAGGAATATGTTTAACTATGCAACAGTGGCGAAAGTTCATGGAGGTGGTACCAGATGTGGACAAAGTTGCAAAGTCAAAGTGTTAG
Protein Sequence: MPKSKEYISDSDDSSEEELKPTKKKQKKEKDEKEDKGDKGDKGASHKKVKSDDVEETIWDLGNNRQVNVRNFKGKYYVDIREMYYDKEGDLKPGKKGICLTMQQWRKFMEVVPDVDKVAKSKC

Sequence clustering based on sequence similarity using MMseqs2