Lhum002993.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Linepithema humile
Gene Symbol
SOX8
Assembly
GCA_000217595.1
Location
NW:756012-773223[-]

Transcription Factor Domain

TF Family
HMG
Domain
HMG_box domain
PFAM
PF00505
TF Group
Other Alpha-Helix Group
Description
High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 2 2e-27 1e-24 86.1 1.2 1 69 60 128 60 128 0.99
2 2 0.92 4.6e+02 0.7 0.5 21 58 208 245 204 262 0.73

Sequence Information

Coding Sequence
ATGGAGACCCATCACAATAACAACGGCTTATCGCCGATGGAGGGTAAGGCCAGTTCATCGAGCAACGAACACGGCAACAATAGTTCCTTGGACGATGCTGTGGGCAAGCTACTGCAAGGATACGACTGGACACTACTTCCGGTAACTTCGCGCGCCGGCGGACGAAGAAGCGCTCACGTGAAGCGTCCCATGAACGCCTTCATGGTATGGGCGCAAGCGGCAAGGCGAAGACTGGCCGACCAGTATCCGCAATTGCACAACGCCGAATTGTCGAAGACGCTGGGAAAATTGTGGAGGATCTTGAGCGACGGCGAGAAACAACCGTTTATTGAGGAAGCTGAGAGACTGCGGAATGCGCACAAGAAGCAACATCCGCACTATAAGTATCAACCGCGCCGGAGGAAGCCTAAGTCGGACGATCAGATGGGCATCATCGTGCACAGAGGCGGACTTCCGTCGCCGGGGACCTCGCACGACTCTTCGGCCGGCTCCACGGATTGCACCTACACCCGCCTGTATCCGGACGCCGGCGTGAAGGCGTACGAGCGGCCGGCGACTTATCACGACCCGAAATCCGGCGCTTACGACCTCGCCAGACCGGTCTGGGTCAACGAGACGGTCGCCAAGTATCCCGATCATCCTAATAAACTGACGTACGAGACGACGGCGAGGAGCTACGCCGAGGCGAAGTGCCACGAGGTTGCCAAGTATCACGAGATGGCCGGCGCCAAGTATCATCACGAGATGACCGGCGCCAAGTACCACCATCATCACGATTCAGCGGCGACCAAGTATCCGGATCTACAGACTAAGCCCTACGACTTGCCCAAGTATTCGGAGGCTAAGGGATACCCGGACGGTCTGAAATACTCCGCGGAGATGAGCggcgccgccgctgccgccgccgccgccgccgctaaGGCACCGTACGCCTGTGTGCACGGACAATATTATCCTGCCGCGGAAGGATACGGCGTCCACGGCGAGGAGAACGACTATCAGCCGCAGAGTATGTCCTCGCATCCCTCCTTTTACCCTTACATATCGGCGTCCATGGCGCAACCACCGTACTACATGGGCCCCCGATAG
Protein Sequence
METHHNNNGLSPMEGKASSSSNEHGNNSSLDDAVGKLLQGYDWTLLPVTSRAGGRRSAHVKRPMNAFMVWAQAARRRLADQYPQLHNAELSKTLGKLWRILSDGEKQPFIEEAERLRNAHKKQHPHYKYQPRRRKPKSDDQMGIIVHRGGLPSPGTSHDSSAGSTDCTYTRLYPDAGVKAYERPATYHDPKSGAYDLARPVWVNETVAKYPDHPNKLTYETTARSYAEAKCHEVAKYHEMAGAKYHHEMTGAKYHHHHDSAATKYPDLQTKPYDLPKYSEAKGYPDGLKYSAEMSGAAAAAAAAAAKAPYACVHGQYYPAAEGYGVHGEENDYQPQSMSSHPSFYPYISASMAQPPYYMGPR