Ladu018082.1
Basic Information
- Insect
- Ligdia adustata
- Gene Symbol
- Sox15
- Assembly
- GCA_947049285.1
- Location
- CAMRIN010000574.1:38418-38810[-]
Transcription Factor Domain
- TF Family
- HMG
- Domain
- HMG_box domain
- PFAM
- PF00505
- TF Group
- Other Alpha-Helix Group
- Description
- High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 3.3e-14 2.7e-11 44.1 0.0 2 37 95 130 94 130 0.97
Sequence Information
- Coding Sequence
- ATGCTAGACTCCGGTGGCGCCGGCATCGAATCTCCTCCTACCTACCACCGCACCTACGAACAATACGTGCAGGGAGCTGTCGACAACAGCGGTGACTCTGCCCAAGACCAGACCAGCCCAGAACTAGTCGTCTGGTCCACACTACCCTATGGCCTAGACTACCGAGCGCAGTACGACTACAGAACCGCATACGAAACTAGGGATTATTCTCCTCAGCAGTACGGAAGACCGCCTTTCACGACGAAGATGGGTCAGGCCAAAGCGTTGAAGGAAGCTAGGATAAGAAGACCTATGAACGCGTTCATGGTCTGGGCGAAGGTGGAGCGGAAGAAACTGGCTGATGAGAATCCGGACCTTCATAATGCGGACCTCAGTAAAATGTTAGGTAAGTGA
- Protein Sequence
- MLDSGGAGIESPPTYHRTYEQYVQGAVDNSGDSAQDQTSPELVVWSTLPYGLDYRAQYDYRTAYETRDYSPQQYGRPPFTTKMGQAKALKEARIRRPMNAFMVWAKVERKKLADENPDLHNADLSKMLGK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01017731; iTF_00666535; iTF_00825739; iTF_00206994; iTF_00044502; iTF_00206071; iTF_00826969; iTF_00143068; iTF_00032911; iTF_00033806; iTF_00774486; iTF_01193589; iTF_00878851; iTF_00114948; iTF_00711017; iTF_00771083; iTF_00710201; iTF_01367907; iTF_01302341; iTF_00288049; iTF_01209273; iTF_01091930; iTF_00801847; iTF_00361627; iTF_01172381; iTF_00818343; iTF_01443847; iTF_00913608; iTF_00935728; iTF_00790266; iTF_00055419; iTF_00791197; iTF_01208191; iTF_00321598; iTF_00706019; iTF_01335939; iTF_00661285; iTF_00697349; iTF_00701989; iTF_01528293; iTF_01509607; iTF_00737482; iTF_01529194; iTF_00686347; iTF_00698318; iTF_00701070; iTF_00318095; iTF_00119600; iTF_00267186; iTF_00662226; iTF_01099829; iTF_00377110; iTF_00638646; iTF_00702903; iTF_00705016; iTF_00696476; iTF_00700124; iTF_01219773; iTF_01161375; iTF_00703968; iTF_01170603; iTF_01171473; iTF_01182898; iTF_00632759; iTF_01429049;
- 90% Identity
- iTF_01172381; iTF_00818343; iTF_01443847; iTF_00913608; iTF_00935728; iTF_00790266; iTF_00055419; iTF_00791197; iTF_01209273;
- 80% Identity
- -