Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0003 1 9.5 0.1 22 46 72 96 68 99 0.89

2 5 0.0078 27 4.9 0.1 21 46 99 124 96 126 0.89

3 5 0.00025 0.85 9.7 0.0 21 45 127 151 123 154 0.91

4 5 0.00035 1.2 9.3 0.2 22 46 156 180 151 187 0.88

5 5 2.2 7.5e+03 -2.9 0.1 37 49 199 211 190 214 0.59

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0003	1	9.5	0.1	22	46	72	96	68	99	0.89
2	5	0.0078	27	4.9	0.1	21	46	99	124	96	126	0.89
3	5	0.00025	0.85	9.7	0.0	21	45	127	151	123	154	0.91
4	5	0.00035	1.2	9.3	0.2	22	46	156	180	151	187	0.88
5	5	2.2	7.5e+03	-2.9	0.1	37	49	199	211	190	214	0.59

Coding Sequence: ATGAATGATTTGCTGAAGACACGTGGGAGGTGTCAGCTGCGGGCGGGCGCTGAGCCTATACTCAAGGCTCTATTTATTTTGTACGTAGATGAAGATTGTTCTCCGGATGATCTGTCCTTAAGAGAGCTGACACAGACGAAGACACCCCAACACTATAACATGAACGATGACACTCGTCGGGAACAAGGACAACATTTGATAATACATTCTAAACAGAGACCTAACACATGTAATATTTGTCAAAAGTGGTTTACTAAAAAGTGTGATTTAACAAGACATTTAAAAATACATTCTGGAGAGAGACCATATGCATGTAATATTTGTCAAAAGAGGTTTACTGATAAGAGTGATTTCACAAGACATTTAAAAATACATTCTGGAGAGAGACCATACACATGTGAAATTTGTCAAAAGAAGTTTTCTGATAAGAGTAATTTGACAAAGCATTTGAAAACACATTCCGGAGAGAGATCATACACATGTAATATTTGTCAAAAAAGGTTTTCTCAAAAGGCTAATTTAACAAAGCATTTGATAATACATTCCATAGAGAGACGATACGCATATGATATTTGTGTAAAGAACTTTTTAAAAAAGAGTCATTTAACAAAGCATTTAATATTGCATTCCAGAGAGAAACCTTAA
Protein Sequence: MNDLLKTRGRCQLRAGAEPILKALFILYVDEDCSPDDLSLRELTQTKTPQHYNMNDDTRREQGQHLIIHSKQRPNTCNICQKWFTKKCDLTRHLKIHSGERPYACNICQKRFTDKSDFTRHLKIHSGERPYTCEICQKKFSDKSNLTKHLKTHSGERSYTCNICQKRFSQKANLTKHLIIHSIERRYAYDICVKNFLKKSHLTKHLILHSREKP

Sequence clustering based on sequence similarity using MMseqs2