Basic Information

Insect: Leptopilina drosophilae
Gene Symbol: ECU03_0790
Assembly: GCA_032873175.1
Location: CM065483.1:4822302-4823276[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.00013 0.027 16.2 0.2 2 23 56 78 56 78 0.95

2 9 0.00032 0.066 15.0 1.7 1 23 82 104 82 104 0.99

3 9 0.0004 0.08 14.7 3.2 1 23 110 133 110 133 0.96

4 9 0.00039 0.079 14.7 1.4 1 23 140 163 140 163 0.94

5 9 6.6 1.3e+03 1.4 0.2 3 11 170 178 168 181 0.84

6 9 0.00037 0.074 14.8 4.0 1 23 198 220 198 220 0.98

7 9 0.00012 0.023 16.4 0.1 1 23 224 246 224 246 0.98

8 9 2.7e-05 0.0055 18.4 0.5 2 23 251 272 250 272 0.97

9 9 9e-07 0.00018 23.0 1.7 1 23 278 300 278 300 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.00013	0.027	16.2	0.2	2	23	56	78	56	78	0.95
2	9	0.00032	0.066	15.0	1.7	1	23	82	104	82	104	0.99
3	9	0.0004	0.08	14.7	3.2	1	23	110	133	110	133	0.96
4	9	0.00039	0.079	14.7	1.4	1	23	140	163	140	163	0.94
5	9	6.6	1.3e+03	1.4	0.2	3	11	170	178	168	181	0.84
6	9	0.00037	0.074	14.8	4.0	1	23	198	220	198	220	0.98
7	9	0.00012	0.023	16.4	0.1	1	23	224	246	224	246	0.98
8	9	2.7e-05	0.0055	18.4	0.5	2	23	251	272	250	272	0.97
9	9	9e-07	0.00018	23.0	1.7	1	23	278	300	278	300	0.98

Sequence Information

Coding Sequence: ATGAGACGAAAACCAAggagagaatttaaaaagacattttttattacaacgATCGATGAAAATGACGAGAACATTGAGGTGAAAAATGAAACTTATCATGGAATTGACGATAGTTATTCAAAGAACGAGCCCGACGTCGATCAAGTGCTTGACAATCTTCGGAATACTTGTCCATTTTGTGAGAAACGATTCAAGGACGAGGCGAAAGTTGAGAGGCACGTGAGGGCAGTTCACAAAAGACCTTACAAATGTGATATGTGCAGAAGATCGTATTTCACCGCTCGTGTCCTCGAGGAGCATCGAAAAACACACAGCAgtgattttttctttgaatgttcaatttgtcatttaaaatataaacgcGAGGAGGGACTTAAGCAGCATCACATTCGTGTTCACAGTGAGACCGAGGCAAAATTCATGTGCGATCATTGTGGCAAGAGGTACAAATTAAAACTCGATCTTTTGCTTCACATCGGCAGAACGCACATGTgtaatattcaaatttgtcgattttgCGGCAAGGCCGTCAAGGATGTCAAGGGACACGAGTGGCGACATCAAAAACGTTCACGCAAATCAACCATGGACTATGTCTGTCATTTGTGCTTTAGAAAATTTCGCAGCAAAACAAAACTCGACAATCATGTATTGATGCACAAGGAGCGTTACACTTGTCAGGAATGCGGTCTCGAATTATCCGGACCAAGTCAATTGATGAATCACAAATTGAAGCATAAACCGGGAATGACTTGCACAGTGTGCGCCAAAGTTTTTATTTCAAGGAGTAATTTTTATCAACACGTTCTCACACACGCCGGCATTAGGCCTTATAAATGTGACGTTTGCAATGAGGATTTCACTCAACGTTCGAGTCTTCTTAGACACAGGAAAAATCATCCTGGACCACTTCCGCCTCTTCTCACACCGACGCCAATCGCCGATCTCGCGAGAAACGTTTTACAAAAActctaa
Protein Sequence: MRRKPRREFKKTFFITTIDENDENIEVKNETYHGIDDSYSKNEPDVDQVLDNLRNTCPFCEKRFKDEAKVERHVRAVHKRPYKCDMCRRSYFTARVLEEHRKTHSSDFFFECSICHLKYKREEGLKQHHIRVHSETEAKFMCDHCGKRYKLKLDLLLHIGRTHMCNIQICRFCGKAVKDVKGHEWRHQKRSRKSTMDYVCHLCFRKFRSKTKLDNHVLMHKERYTCQECGLELSGPSQLMNHKLKHKPGMTCTVCAKVFISRSNFYQHVLTHAGIRPYKCDVCNEDFTQRSSLLRHRKNHPGPLPPLLTPTPIADLARNVLQKL

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00980409;
90% Identity: iTF_00883288; iTF_00882441;
80% Identity: -