Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 6.4e-16 3.4e-13 51.1 0.2 3 69 7 71 5 71 0.92

2 3 2.1e-27 1.1e-24 88.0 0.5 8 109 68 167 67 168 0.94

3 3 0.067 35 5.9 0.0 78 107 168 197 165 200 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	6.4e-16	3.4e-13	51.1	0.2	3	69	7	71	5	71	0.92
2	3	2.1e-27	1.1e-24	88.0	0.5	8	109	68	167	67	168	0.94
3	3	0.067	35	5.9	0.0	78	107	168	197	165	200	0.89

Coding Sequence: ATGTTGAGAGAATACGAACCGTTTTTAAATAGCGAGATTTTAAGTGACATCACAATTCAGGTTGGCGAGAAAATTTATCAATGTCACAAATTAGTTTTAGCTGCTAAAAGTCCAGTTTTGAGAAGAATGCTAATGAGCAATATGAAAGAagctattaacaattttatcgaaattaaagACATGAAAGTTGAAGTGTTTCAAGAAGTTCTCAGTGACATTACTATTCGAGTCGACGAAAGGAATTTTCAATGTCACAAAATTATTCTTGCTGCAAAAAGTCAAATACTACGTGAATTACTTACGAACCACGTGAATGAAAATCTTGGAAATGTCATGGAACTTACAGATATTAAAGCtgaaatttttgaagaggttctcagATACATGTACACTGGAAAAGTGAATAATCTACAAGAGTACGGTATCGATATTTTAAGAGCCGCAAATCAGTACAAATTggaacatttgaaaaatatgtgTGAAGAATTTCTTGTGGCAAAATTAACACACGATAATGTGGTGGAAACGTTAAAGATTGCAGACGCTTGTAATGCTCCATTTCTCGTTAAACATTGCAGCCATTACATTCTAAAGtacataatttcaaatttccaaaGAAAGGAATTTAGTAAGAGAATTAATCTCGACATGTTTATTACTTGTCGGCACAATATTTTCTACGAATTTCTAAATGTACTGAGCAAATCTTGCCAGGTTTTGtataactaa
Protein Sequence: MLREYEPFLNSEILSDITIQVGEKIYQCHKLVLAAKSPVLRRMLMSNMKEAINNFIEIKDMKVEVFQEVLSDITIRVDERNFQCHKIILAAKSQILRELLTNHVNENLGNVMELTDIKAEIFEEVLRYMYTGKVNNLQEYGIDILRAANQYKLEHLKNMCEEFLVAKLTHDNVVETLKIADACNAPFLVKHCSHYILKYIISNFQRKEFSKRINLDMFITCRHNIFYEFLNVLSKSCQVLYN

Sequence clustering based on sequence similarity using MMseqs2