Lpau017118.1
Basic Information
- Insect
- Lasioglossum pauxillum
- Gene Symbol
- bs
- Assembly
- GCA_028455745.1
- Location
- CM052305.1:26727086-26732787[+]
Transcription Factor Domain
- TF Family
- SRF
- Domain
- SRF domain
- PFAM
- PF00319
- TF Group
- Helix-turn-helix
- Description
- Serum response factor (SRF) is a ubiquitous nuclear protein important for cell proliferation and differentiation. SRF function is essential for transcriptional regulation of numerous growth-factor-inducible genes, such as c-fos oncogene and muscle-specific actin genes. A core domain of around 90 amino acids is sufficient for the activities of DNA-binding, dimerisation and interaction with accessory factors. Within the core is a DNA-binding region, designated the MADS box [2], that is highly similar to many eukaryotic regulatory proteins: among these are MCM1, the regulator of cell type-specific genes in fission yeast; DSRF, a Drosophila trachea development factor; the MEF2 family of myocyte-specific enhancer factors; and the Agamous and Deficiens families of plant homeotic proteins. In SRF, the MADS box has been shown to be involved in DNA-binding and dimerisation [1]. Proteins belonging to the MADS family function as dimers, the primary DNA-binding element of which is an anti-parallel coiled coil of two amphipathic α-helices, one from each subunit. The DNA wraps around the coiled coil allowing the basic N-termini of the helices to fit into the DNA major groove. The chain extending from the helix N-termini reaches over the DNA backbone and penetrates into the minor groove. A 4-stranded, anti-parallel β-sheet packs against the coiled-coil face opposite the DNA and is the central element of the dimerisation interface. The MADS-box domain is commonly found associated with K-box region see (IPR002487).
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 6.7e-25 8.7e-21 73.6 0.1 1 48 139 186 139 186 0.98
Sequence Information
- Coding Sequence
- ATGGACAACCCTAGCGGCGGAAGAGATAGTCGGTACGCAAGTCTTGGGTACAGCATGGGGATGATAGGCAGCGACGCTGGCTCGGAAATGTACGGCCGACCGTCCACCTCCCAGCTTACAACTTCTCAAATAAGCCGCGGTGGCGCCACTATGATGGCCGCGGCGGCGGCTGCTGCAGGCGGACCAAACGCCGGCGTGGGACCTGTACAAAGAGGTATCAAGAGGACCACAACGGACGTCTGTTACGATGACAGCAACGCACGGCAAGCGCTTTCGCAACAACAAGGCATGTCGATGTCCGGAGACTGTGTACCCGACAATTTGGAAGAATCGTTCACCAGTTTGGGCCAACCGAAAAAGTCGCCGCCTTCGAACGGCAAGAAGACCAAGGGACGGGTCAAGATTAAAATGGAGTATATCGACAATAAACTAAGGAGGTATACCACCTTCTCCAAAAGGAAAACCGGAATCATGAAGAAGGCGTACGAGCTGTCGACGCTGACAGGTACGCAGGTGATGCTGTTGGTGGCCAGCGAGACGGGCCACGTGTACACGTTCGCGACACGGAAGTTGCAGCCGATGATAACGAGCGAGGCCGGGAAAGCATTGATCCAGACCTGCCTGAACAGCCCGGATCCACCGACCTCGGGTTCGTCCGGTGATCAGAGGATGTCGGCGACCGGGTTCGAGGAGACCGAACTGACCTACAACATAGCCGACGACGAGCAGAAAGGCCCCCCCGGCCACCCGCAACCCCCGCCGCCGCCGCCCCCGGGTTCGCAGCACGCGCCACCCTCGCACGCGCAGCACGCGCACCTGATCGCGCATGCACACGCGGGCTCATCGAGCTCGCACCTGGTCCCGTGCTCAAGCCCGGGCCCCATGCTGGCCGGCGGTCCCTATCAACAATCCTGCCCCTCGCCCCTGCCGCCCCATCACGCCGCCTACCATCCGCACATGTCGCACTCACATCCCCAACGGTAG
- Protein Sequence
- MDNPSGGRDSRYASLGYSMGMIGSDAGSEMYGRPSTSQLTTSQISRGGATMMAAAAAAAGGPNAGVGPVQRGIKRTTTDVCYDDSNARQALSQQQGMSMSGDCVPDNLEESFTSLGQPKKSPPSNGKKTKGRVKIKMEYIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMITSEAGKALIQTCLNSPDPPTSGSSGDQRMSATGFEETELTYNIADDEQKGPPGHPQPPPPPPPGSQHAPPSHAQHAHLIAHAHAGSSSSHLVPCSSPGPMLAGGPYQQSCPSPLPPHHAAYHPHMSHSHPQR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00125881;
- 90% Identity
- iTF_00141190; iTF_00227233; iTF_00233185; iTF_00221218; iTF_01068931; iTF_01066212; iTF_01418308; iTF_00218374; iTF_00982246; iTF_01539561; iTF_01420234; iTF_00219755; iTF_00675979; iTF_00231276; iTF_00762508; iTF_00982924; iTF_01418956; iTF_00088781; iTF_01419597; iTF_00087118; iTF_00228624; iTF_01066897; iTF_01067569; iTF_01424337; iTF_00215666; iTF_00227922; iTF_00763186; iTF_01070322; iTF_00087955; iTF_00222484; iTF_01065526; iTF_00223831; iTF_01069624; iTF_00220537; iTF_00873753; iTF_01420890; iTF_00216348; iTF_01417660; iTF_00140541; iTF_00183901; iTF_00219069; iTF_01068255; iTF_00229984; iTF_00866661; iTF_00962469; iTF_00861094; iTF_00861831; iTF_00863911; iTF_00863227; iTF_01169128; iTF_00302987; iTF_00360172; iTF_00963148; iTF_00964436; iTF_00961782; iTF_00864594; iTF_00633587; iTF_00085333; iTF_00084509; iTF_01454045;
- 80% Identity
- -