Lcur009979.1
Basic Information
- Insect
- Lamproptera curius
- Gene Symbol
- -
- Assembly
- GCA_029286875.1
- Location
- JAGSMT010000027.1:163139-163666[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 0.078 3.4e+03 -0.5 0.1 23 34 8 19 4 33 0.74 2 6 0.0064 2.8e+02 3.0 0.1 21 32 34 45 26 60 0.74 3 6 2.6e-06 0.11 13.8 0.1 21 52 62 93 51 94 0.87 4 6 4.5e-05 2 9.9 0.2 23 49 92 119 88 123 0.86 5 6 0.069 3e+03 -0.3 0.0 24 45 118 139 117 142 0.82 6 6 9.3e-05 4 8.9 0.1 21 43 143 165 132 172 0.90
Sequence Information
- Coding Sequence
- ATGAGAGTCCACACTGGTCGGAAGCCTTATACATGTAGCTTCTGCGACCGGCAGTTCGCCCAAATGGCCAGCTTTAAGCTCCACGAGCGCACCCACACGGGTGAGAGGCCGTACACTTGTGAAGTGTGCAAGAAACCGTTCTCAGACAATGGCTACTTAAAGATCCACATGCGAGTGCATACGGGTGAAAAACCTTATACTTGTGACGTGTGCAAGCGCTCCTTCCGTGAGACTGGTCAGCTGAAAAGGCACATGAGAGTGCACACTGGTATCAAACCGTATACATGCAAAATCTGCAACAAACAAATCGGTAACCTGTCCAAACATATGCGCGTGCACTCCGAAGTGAGACCGTTCAATtgcagcgtttgcaataaacAGTTCTCGATAAATGGAAATCTAAAACTTCATATGCGCATTCACACTGGCGAAAGACCGTTCGTATGTGAGCTTTGCAATAGCCAGTTCACACAGAGCAGCGGTCTTAAGAGGCATAGGTGTACACATGTCGATAAGGTCAGTCCTTGA
- Protein Sequence
- MRVHTGRKPYTCSFCDRQFAQMASFKLHERTHTGERPYTCEVCKKPFSDNGYLKIHMRVHTGEKPYTCDVCKRSFRETGQLKRHMRVHTGIKPYTCKICNKQIGNLSKHMRVHSEVRPFNCSVCNKQFSINGNLKLHMRIHTGERPFVCELCNSQFTQSSGLKRHRCTHVDKVSP
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00856057; iTF_00112766;
- 90% Identity
- iTF_00856057;
- 80% Identity
- iTF_00856057;