Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.078 3.4e+03 -0.5 0.1 23 34 8 19 4 33 0.74

2 6 0.0064 2.8e+02 3.0 0.1 21 32 34 45 26 60 0.74

3 6 2.6e-06 0.11 13.8 0.1 21 52 62 93 51 94 0.87

4 6 4.5e-05 2 9.9 0.2 23 49 92 119 88 123 0.86

5 6 0.069 3e+03 -0.3 0.0 24 45 118 139 117 142 0.82

6 6 9.3e-05 4 8.9 0.1 21 43 143 165 132 172 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.078	3.4e+03	-0.5	0.1	23	34	8	19	4	33	0.74
2	6	0.0064	2.8e+02	3.0	0.1	21	32	34	45	26	60	0.74
3	6	2.6e-06	0.11	13.8	0.1	21	52	62	93	51	94	0.87
4	6	4.5e-05	2	9.9	0.2	23	49	92	119	88	123	0.86
5	6	0.069	3e+03	-0.3	0.0	24	45	118	139	117	142	0.82
6	6	9.3e-05	4	8.9	0.1	21	43	143	165	132	172	0.90

Coding Sequence: ATGAGAGTCCACACTGGTCGGAAGCCTTATACATGTAGCTTCTGCGACCGGCAGTTCGCCCAAATGGCCAGCTTTAAGCTCCACGAGCGCACCCACACGGGTGAGAGGCCGTACACTTGTGAAGTGTGCAAGAAACCGTTCTCAGACAATGGCTACTTAAAGATCCACATGCGAGTGCATACGGGTGAAAAACCTTATACTTGTGACGTGTGCAAGCGCTCCTTCCGTGAGACTGGTCAGCTGAAAAGGCACATGAGAGTGCACACTGGTATCAAACCGTATACATGCAAAATCTGCAACAAACAAATCGGTAACCTGTCCAAACATATGCGCGTGCACTCCGAAGTGAGACCGTTCAATtgcagcgtttgcaataaacAGTTCTCGATAAATGGAAATCTAAAACTTCATATGCGCATTCACACTGGCGAAAGACCGTTCGTATGTGAGCTTTGCAATAGCCAGTTCACACAGAGCAGCGGTCTTAAGAGGCATAGGTGTACACATGTCGATAAGGTCAGTCCTTGA
Protein Sequence: MRVHTGRKPYTCSFCDRQFAQMASFKLHERTHTGERPYTCEVCKKPFSDNGYLKIHMRVHTGEKPYTCDVCKRSFRETGQLKRHMRVHTGIKPYTCKICNKQIGNLSKHMRVHSEVRPFNCSVCNKQFSINGNLKLHMRIHTGERPFVCELCNSQFTQSSGLKRHRCTHVDKVSP

Sequence clustering based on sequence similarity using MMseqs2