Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010000100.1:4522-6491[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 18 1.3 19 6.1 0.1 3 21 65 83 64 84 0.95

2 18 0.7 9.9 7.0 0.4 1 18 129 146 129 151 0.86

3 18 1.1e-05 0.00016 22.1 1.5 1 23 156 178 156 178 0.98

4 18 0.0075 0.11 13.2 2.2 1 23 183 205 183 205 0.99

5 18 0.0055 0.077 13.6 1.1 1 23 237 259 237 259 0.98

6 18 0.013 0.18 12.4 0.6 1 23 264 286 264 286 0.98

7 18 7.9e-05 0.0011 19.4 3.7 1 23 291 313 291 313 0.98

8 18 0.15 2.2 9.0 1.0 1 23 318 340 318 340 0.97

9 18 0.51 7.3 7.4 2.5 1 20 345 364 345 367 0.93

10 18 0.0099 0.14 12.8 2.1 1 23 372 394 372 394 0.99

11 18 0.019 0.26 11.9 2.0 1 23 399 421 399 421 0.98

12 18 0.065 0.92 10.2 1.4 1 23 426 448 426 448 0.99

13 18 0.012 0.17 12.5 2.8 1 23 453 475 453 475 0.99

14 18 0.36 5.2 7.9 2.5 1 20 480 499 480 502 0.93

15 18 0.058 0.82 10.4 1.6 1 23 507 529 507 529 0.99

16 18 0.1 1.5 9.6 1.1 1 23 534 556 534 556 0.98

17 18 0.027 0.38 11.4 2.0 1 23 561 583 561 583 0.99

18 18 0.004 0.057 14.0 1.6 1 23 588 610 588 610 0.99

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	18	1.3	19	6.1	0.1	3	21	65	83	64	84	0.95
2	18	0.7	9.9	7.0	0.4	1	18	129	146	129	151	0.86
3	18	1.1e-05	0.00016	22.1	1.5	1	23	156	178	156	178	0.98
4	18	0.0075	0.11	13.2	2.2	1	23	183	205	183	205	0.99
5	18	0.0055	0.077	13.6	1.1	1	23	237	259	237	259	0.98
6	18	0.013	0.18	12.4	0.6	1	23	264	286	264	286	0.98
7	18	7.9e-05	0.0011	19.4	3.7	1	23	291	313	291	313	0.98
8	18	0.15	2.2	9.0	1.0	1	23	318	340	318	340	0.97
9	18	0.51	7.3	7.4	2.5	1	20	345	364	345	367	0.93
10	18	0.0099	0.14	12.8	2.1	1	23	372	394	372	394	0.99
11	18	0.019	0.26	11.9	2.0	1	23	399	421	399	421	0.98
12	18	0.065	0.92	10.2	1.4	1	23	426	448	426	448	0.99
13	18	0.012	0.17	12.5	2.8	1	23	453	475	453	475	0.99
14	18	0.36	5.2	7.9	2.5	1	20	480	499	480	502	0.93
15	18	0.058	0.82	10.4	1.6	1	23	507	529	507	529	0.99
16	18	0.1	1.5	9.6	1.1	1	23	534	556	534	556	0.98
17	18	0.027	0.38	11.4	2.0	1	23	561	583	561	583	0.99
18	18	0.004	0.057	14.0	1.6	1	23	588	610	588	610	0.99

Sequence Information

Coding Sequence: ATGGACTCCGTATATAATAAAAGTTGCccaataaaatctgaagtgatagtaaatgaaacattttcctGTTGTGGAAAATATGGAGATTGTGGGATTGAAGAATTGAAAACGGAACCGGTAGATTTTGAATGCAAAGAAGAAGATAATCTTGAAGAGGACACCTACCAAAGTATCCCTGTGcatcaaaatatttgtaacgaatgtaattttattgcaaCGGCAAaagattctctaatagaacatatgaaatttactaaaaatgttcattatttttgcaaggaatgtaattttacaaccCTGTTTGAATGTTCTATGAAGCAACATTCCAGGATCCACAACGGAGTTGGTAcaCCACATTTGAAAGCTCCAAAAAGTGGTGATGAATATGTAtgtaagaaatgtgattataaaacaccgcAGAAACGGAGTATGAACAAACCTATGAGAATTCATATTGGTGATCAATATAGGTGTAccgagtgtgattataaaacctcAAGGAAAAGTAGTCTAACAATACATATGACAATTCAtattggtgatgaatataagtgtaatgaatgtgattataaaacaaggtggaaacagaatctaaaggaacatgtaaaacgtcatactggtgatgaacataagtgtattaagtgtgattttaaaacaatatggaaacagagtctaaaggaacatgtgaaaattcatactgatggggaatataaatgtaaagaatgtgattataaaacatcatggaaacagaatctaaacgaacatgtgaaaattcatattgatggtgaatataagtgtaaagaatgtgattataaaacaccatggaaacagaatctaaacgaacatgtgaaaattcatattggtgatgaatataagtgtacagagtgtgattttaaaacatcaaaGAAAAGTCATCTAACAAGCCATATGATAGTTCAtattggtgatgaatataagtgtacggaatgtgattataaaacaaaatggatacggagtctaaaggaacatgtgaaaattcatactaatggtgaatataagtgtaaggaatgtgattataaaacagtatggaaaggGAATCTAAAGATACATGCAAAGTGTCATATTGAtggtgaatataagtgtaaacaatgtgattataaaacagtatggaaagggaatctaaagaaacatgcaAAACGTCATACGGATggagaatataagtgtaaagaatgtgattataaaacaaaatggaaacggagtctaaaggaacatgtgaaaattcatattggtgatgaatataagtgtacagagtgtgattttaaaacaatatggaaacagagtctaaaggaacatgtgaaaactCATACTGATGgtgaatacaagtgtaaggaatgtgattataaaacaaaatggaaacggagtctaaaggaacatgtgaaaactCATACTGATGgggaatataaatgtaaagactgtgattataaaacagtatggaaaggGAATCTAAAGATACATGCAAAGTGTCATATTGATggtgaatacaagtgtaaagaatgtgattttaaaacaatatggaaacagagtctaaaggaacatgtgaaaactCATACtgatgaagaatataagtgtaaagaatgtgattttaaaacaatatggaaacagagtctaaaggaacatgtgaaaattcatattgGTGGTGAATATGAGTGTACggaatgcaattataaaacaaaatggaaacggagtctaaaggaacatgtgaaaactCATACtgatgaagaatataagtgtaaagaatgtgattacaaaacagtatggaaagggaatctaaagaaacatgcaAAACGTCATACTGTTGATAAATAtgagtgtaaggaatgtgactattaA
Protein Sequence: MDSVYNKSCPIKSEVIVNETFSCCGKYGDCGIEELKTEPVDFECKEEDNLEEDTYQSIPVHQNICNECNFIATAKDSLIEHMKFTKNVHYFCKECNFTTLFECSMKQHSRIHNGVGTPHLKAPKSGDEYVCKKCDYKTPQKRSMNKPMRIHIGDQYRCTECDYKTSRKSSLTIHMTIHIGDEYKCNECDYKTRWKQNLKEHVKRHTGDEHKCIKCDFKTIWKQSLKEHVKIHTDGEYKCKECDYKTSWKQNLNEHVKIHIDGEYKCKECDYKTPWKQNLNEHVKIHIGDEYKCTECDFKTSKKSHLTSHMIVHIGDEYKCTECDYKTKWIRSLKEHVKIHTNGEYKCKECDYKTVWKGNLKIHAKCHIDGEYKCKQCDYKTVWKGNLKKHAKRHTDGEYKCKECDYKTKWKRSLKEHVKIHIGDEYKCTECDFKTIWKQSLKEHVKTHTDGEYKCKECDYKTKWKRSLKEHVKTHTDGEYKCKDCDYKTVWKGNLKIHAKCHIDGEYKCKECDFKTIWKQSLKEHVKTHTDEEYKCKECDFKTIWKQSLKEHVKIHIGGEYECTECNYKTKWKRSLKEHVKTHTDEEYKCKECDYKTVWKGNLKKHAKRHTVDKYECKECDY

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00854842;
90% Identity: -
80% Identity: -