Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010001223.1:2231991-2238019[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 17 1.1 15 6.4 0.4 1 18 59 76 59 81 0.85

2 17 9.5e-06 0.00013 22.3 1.5 1 23 86 108 86 108 0.98

3 17 0.0065 0.092 13.4 2.2 1 23 113 135 113 135 0.99

4 17 0.0047 0.067 13.8 1.1 1 23 167 189 167 189 0.98

5 17 0.086 1.2 9.8 3.0 1 23 194 216 194 216 0.98

6 17 6.9e-05 0.00097 19.6 3.7 1 23 221 243 221 243 0.98

7 17 0.4 5.7 7.7 0.9 1 23 248 270 248 270 0.95

8 17 0.45 6.3 7.6 2.5 1 20 275 294 275 297 0.93

9 17 0.024 0.33 11.6 0.7 1 23 302 324 302 324 0.99

10 17 0.74 10 6.9 3.8 1 21 329 349 329 351 0.95

11 17 0.1 1.5 9.6 0.9 1 23 356 378 356 378 0.98

12 17 0.035 0.5 11.0 1.8 1 23 383 405 383 405 0.97

13 17 0.00045 0.0064 17.0 0.6 1 23 410 432 410 432 0.99

14 17 0.0017 0.024 15.2 2.8 1 23 437 459 437 459 0.99

15 17 0.0011 0.016 15.8 1.7 1 23 464 486 464 486 0.98

16 17 0.012 0.17 12.5 1.6 1 23 491 513 491 513 0.99

17 17 0.0024 0.034 14.7 1.7 1 23 518 540 518 540 0.99

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	17	1.1	15	6.4	0.4	1	18	59	76	59	81	0.85
2	17	9.5e-06	0.00013	22.3	1.5	1	23	86	108	86	108	0.98
3	17	0.0065	0.092	13.4	2.2	1	23	113	135	113	135	0.99
4	17	0.0047	0.067	13.8	1.1	1	23	167	189	167	189	0.98
5	17	0.086	1.2	9.8	3.0	1	23	194	216	194	216	0.98
6	17	6.9e-05	0.00097	19.6	3.7	1	23	221	243	221	243	0.98
7	17	0.4	5.7	7.7	0.9	1	23	248	270	248	270	0.95
8	17	0.45	6.3	7.6	2.5	1	20	275	294	275	297	0.93
9	17	0.024	0.33	11.6	0.7	1	23	302	324	302	324	0.99
10	17	0.74	10	6.9	3.8	1	21	329	349	329	351	0.95
11	17	0.1	1.5	9.6	0.9	1	23	356	378	356	378	0.98
12	17	0.035	0.5	11.0	1.8	1	23	383	405	383	405	0.97
13	17	0.00045	0.0064	17.0	0.6	1	23	410	432	410	432	0.99
14	17	0.0017	0.024	15.2	2.8	1	23	437	459	437	459	0.99
15	17	0.0011	0.016	15.8	1.7	1	23	464	486	464	486	0.98
16	17	0.012	0.17	12.5	1.6	1	23	491	513	491	513	0.99
17	17	0.0024	0.034	14.7	1.7	1	23	518	540	518	540	0.99

Sequence Information

Coding Sequence: atgatgaaaattccgttaacttgtaatcacgaaagaagagccttgtgtcatcaaattgatgcgtaccAATTAAGATTagaaaaGATCCACAACGGGGTTGATAGTAAACatatgacaaaaaaatataactataatACGTCACCACATTTGAAAGTTCCAAAATGTGGTGATGAATATATAtgtaagaaatgtgattataaaacaccgcAGAAACGGAGTATGAACAAACCTATGAGAATTCATATTGGTGATCAATATAGGTGTAccgagtgtgattataaaacctcAAGGAAAAGTAGTCTAACAATACATATGACAATTCAtattggtgatgaatataagtgtaatgaatgtgattataaaacaaggtggaaacagaatctaaaggaacatgtaaaacgtcatactggtgatgaacataagtgtattaagtgtgattttaaaacaatatggaaacagagtctaaaggaacatatgataACTCATACTGATGgggaatataaatgtaaagaatgtgattataaaacatcatggaaacagaatctaaacgaacatgtgaaaattcatattgatggtgaatacaagtgtaaagaatgtgattataaaacaccatggaaacagaatctaaaggaCCATGTAAAACatcatactggtaatgaatataagtgtacagagtgtgattttaaaacatcaaaGAAAAGTCATCTAACAAGCCATATGATAGTTCAtattggtgatgaatataagtgtacggaatgtgattataaaacaaaatggatacggagtctaaaggaacatgggAAAATTCATACTAAtggtgaatataagtgtaaggagtgtgattacaaaacagtatggaaaggGAATCTAAAGATACATGCAAAGTGTCATATTGAtggtgaatataagtgtaaacaatgtgattataaaacagcatgggaAGGAAATCTAAAGATACATGTTAAACGTCATACGGATggagaatataagtgtaaagaatgtgactatgaAACAAAATGGAAACGGAGTTTAAGGGAACATATAAAATgccatacaggtgatgaatataagtgtactgagtgtgattttaaaacaatatggaaacagagtctaaaggaacatgtgaaaattcatactgatggtgcatacaagtgtaaggaatgtgattataaaacaaaatggaaacgtagtctaaaggaacatgtgaaagcTCATACTGATGgggaatataaatgtaaagactgtgattataaaacagtatggcaaaGTAACCTAAAGGCTCATGTGAAAGTTCATACCGATagtgaatacaagtgtaaagaatgtgattttaaaacatcatGGAAAAAGAATCTAAAGGATCATATAAGAcgtcacactggtgatgaatataaatgtttagagtgcgattttaaaacaacaatgaaaaataatCTAACAAGTCATATGACAGTTCATGTTGGTGATGAATATGAGTGTAcggaatgcgattataaaacaaaatggaaacggagtctaaaggaacatgtgaaaactCATACTGAtgaagaatataaatgtaaagactgtgattacaaaacagtatggaaagggaatctaaagaaacatgcaAAACGTCATACTGTTGATAAATAtgagtgtaaggaatgtgactattaA
Protein Sequence: MMKIPLTCNHERRALCHQIDAYQLRLEKIHNGVDSKHMTKKYNYNTSPHLKVPKCGDEYICKKCDYKTPQKRSMNKPMRIHIGDQYRCTECDYKTSRKSSLTIHMTIHIGDEYKCNECDYKTRWKQNLKEHVKRHTGDEHKCIKCDFKTIWKQSLKEHMITHTDGEYKCKECDYKTSWKQNLNEHVKIHIDGEYKCKECDYKTPWKQNLKDHVKHHTGNEYKCTECDFKTSKKSHLTSHMIVHIGDEYKCTECDYKTKWIRSLKEHGKIHTNGEYKCKECDYKTVWKGNLKIHAKCHIDGEYKCKQCDYKTAWEGNLKIHVKRHTDGEYKCKECDYETKWKRSLREHIKCHTGDEYKCTECDFKTIWKQSLKEHVKIHTDGAYKCKECDYKTKWKRSLKEHVKAHTDGEYKCKDCDYKTVWQSNLKAHVKVHTDSEYKCKECDFKTSWKKNLKDHIRRHTGDEYKCLECDFKTTMKNNLTSHMTVHVGDEYECTECDYKTKWKRSLKEHVKTHTDEEYKCKDCDYKTVWKGNLKKHAKRHTVDKYECKECDY

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00855040;
90% Identity: -
80% Identity: -