Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010000047.1:1711939-1713548[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 13 0.00046 0.0065 17.0 1.4 1 23 165 187 165 187 0.99

2 13 0.00033 0.0046 17.4 2.2 2 23 193 214 192 214 0.97

3 13 0.00017 0.0024 18.4 0.9 2 23 220 241 219 241 0.96

4 13 0.00025 0.0035 17.8 1.0 2 23 247 268 246 268 0.97

5 13 0.00019 0.0027 18.2 1.2 2 23 274 295 273 295 0.97

6 13 0.022 0.32 11.7 2.8 2 23 301 322 300 322 0.97

7 13 0.016 0.23 12.1 1.1 2 23 328 349 327 349 0.97

8 13 0.00041 0.0058 17.1 1.4 2 23 355 376 354 376 0.97

9 13 0.00025 0.0035 17.8 1.0 2 23 382 403 381 403 0.97

10 13 0.0001 0.0014 19.1 2.7 2 23 409 430 408 430 0.97

11 13 0.099 1.4 9.6 2.7 2 23 436 457 435 457 0.97

12 13 0.014 0.2 12.3 1.4 2 23 463 484 462 484 0.97

13 13 0.00075 0.011 16.3 1.8 2 23 490 511 489 511 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	13	0.00046	0.0065	17.0	1.4	1	23	165	187	165	187	0.99
2	13	0.00033	0.0046	17.4	2.2	2	23	193	214	192	214	0.97
3	13	0.00017	0.0024	18.4	0.9	2	23	220	241	219	241	0.96
4	13	0.00025	0.0035	17.8	1.0	2	23	247	268	246	268	0.97
5	13	0.00019	0.0027	18.2	1.2	2	23	274	295	273	295	0.97
6	13	0.022	0.32	11.7	2.8	2	23	301	322	300	322	0.97
7	13	0.016	0.23	12.1	1.1	2	23	328	349	327	349	0.97
8	13	0.00041	0.0058	17.1	1.4	2	23	355	376	354	376	0.97
9	13	0.00025	0.0035	17.8	1.0	2	23	382	403	381	403	0.97
10	13	0.0001	0.0014	19.1	2.7	2	23	409	430	408	430	0.97
11	13	0.099	1.4	9.6	2.7	2	23	436	457	435	457	0.97
12	13	0.014	0.2	12.3	1.4	2	23	463	484	462	484	0.97
13	13	0.00075	0.011	16.3	1.8	2	23	490	511	489	511	0.97

Sequence Information

Coding Sequence: ATGGATGTTGATTGCAATGAAAGTTGTCCAGTAAAATCTGATGTTACTCTAactgaaacattttctttttgtgaagAATTCAGAGATTATgggaataaaaaattgaaattggagCCAGTAGATAtcgaagaatcttttaaatgcaaGGAAGAAGATAACCCTGCAGAGCAAATGGATATATCTGCTGATCCTGTACGACAACATACTTGTATTAATTGTAACTGTAGAACAACGGAAAGGGATTGTCTAATAAAACATCTGAAAAGTACTAAAAACATTGAACATTTGtgtaaacaatgtaattttaaaactctATTGGAATGTTCCATGAATGAAGATCATGGAATAATtagcaaatgtaattttgagacACCTCAAATTATCTCTATAACACAACAATTGAAAACGGACGAAAGTGGTGATTACTATATTTGTAATAAAGGTAGTTTTAAAACACAATGGAAACATAAACTaaatgtacatataaataagtataagtgtaaggaatgtgattttaaaacggtGTGGAAATCAAATCTTAAcaatcatatgaaaattcacacaggtgatatattgaagtgtaaaaaatgtgactacaaaactcctaGGAAACGCAATCTTGacacacatatgaaaattcacacaggtgataaaTTGaactgtaaggaatgtgactacaaaactcctaGGAAACAGGATCTTAacacacatatgaaaattcatacaggtgatgaattgaagtgtaaagaatgtaactacAAAACTCCTAGGAGACAAGATCTTATcacacatatgaaaattcacacaggtgataaattgaaatgtaaagaatgtgaataCAGAACTGCTAGGAAACAGGATCTTAacacacatatgaaaattcatacaggtgatgaattaaagtgtaaagaatgtgactacaaaactgtATGGAAATGTAATCTTAACAACCATATGAAAGTTCACACAGATGATAAATTGAAGTGTACacaatgtgactacaaaactcctaagaaatatatattaaaagaacatatgagaattcatacaggtgatgaattgaagtgtgtggaatgtgattacaaaactcCTAGGAAACGAAATTTTAACACGCATATGaaaatccatacaggtgatgaattgaagtgtaaagaatgtaactataaaactcCTAGGAGACAAGATCTTATcacacatatgaaaattcacacaggtgataaattgaaatgtaaaggatgtgactacaaaactgcTAGGAAACACGATCTTAACACACATATGAAAATACATTCAGGTGGCgaattgaagtgtaaagaatgtgattataaaactgtgtggaaatGTAATCTTAACAACCATATAAAACTTCACACAGATGATAAATTGAAGTGTAAacaatgtgactacaaaactcctaagaaatatatattaaaagaacatatgagaattcatacaggtgatgaattgaagTGTACCGAATGTTACTACAAAACACCTAGGAAGCAATCTCTTATTACCCATATGAAAACTCACACACGTGATACATTGAAGTGTTAG
Protein Sequence: MDVDCNESCPVKSDVTLTETFSFCEEFRDYGNKKLKLEPVDIEESFKCKEEDNPAEQMDISADPVRQHTCINCNCRTTERDCLIKHLKSTKNIEHLCKQCNFKTLLECSMNEDHGIISKCNFETPQIISITQQLKTDESGDYYICNKGSFKTQWKHKLNVHINKYKCKECDFKTVWKSNLNNHMKIHTGDILKCKKCDYKTPRKRNLDTHMKIHTGDKLNCKECDYKTPRKQDLNTHMKIHTGDELKCKECNYKTPRRQDLITHMKIHTGDKLKCKECEYRTARKQDLNTHMKIHTGDELKCKECDYKTVWKCNLNNHMKVHTDDKLKCTQCDYKTPKKYILKEHMRIHTGDELKCVECDYKTPRKRNFNTHMKIHTGDELKCKECNYKTPRRQDLITHMKIHTGDKLKCKGCDYKTARKHDLNTHMKIHSGGELKCKECDYKTVWKCNLNNHIKLHTDDKLKCKQCDYKTPKKYILKEHMRIHTGDELKCTECYYKTPRKQSLITHMKTHTRDTLKC

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00854649;
90% Identity: -
80% Identity: -