Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 3.3e-09 1.3e-06 29.2 0.0 9 49 23 60 18 70 0.83

2 6 3.3e-06 0.0013 19.6 0.3 21 49 69 95 58 105 0.74

3 6 3.4e-06 0.0013 19.5 0.3 21 49 104 130 93 140 0.74

4 6 3.1e-06 0.0012 19.7 0.3 21 49 139 165 128 176 0.74

5 6 3.1e-14 1.2e-11 45.4 0.1 21 97 174 251 163 266 0.81

6 6 0.5 1.9e+02 2.9 0.0 77 107 265 295 259 298 0.81

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	3.3e-09	1.3e-06	29.2	0.0	9	49	23	60	18	70	0.83
2	6	3.3e-06	0.0013	19.6	0.3	21	49	69	95	58	105	0.74
3	6	3.4e-06	0.0013	19.5	0.3	21	49	104	130	93	140	0.74
4	6	3.1e-06	0.0012	19.7	0.3	21	49	139	165	128	176	0.74
5	6	3.1e-14	1.2e-11	45.4	0.1	21	97	174	251	163	266	0.81
6	6	0.5	1.9e+02	2.9	0.0	77	107	265	295	259	298	0.81

Coding Sequence: ATGTGTGTGGTTTTGTCAGGCACGACGCTGGAGCAGGACATGTGCGTGCTGCTGGGCGGCGGCGCCGAGCTGGCCGACGTGCGCCTGCGGGTGGGCGCCGCGCACCGCCCCGCGCACCGCTCTGTGCTGGCCGCGCGCGCCGCCTACTTCGAGGCCATGTTCCGCTCCTTCTCGCCGCACGACAACATCGTCAATGTAAGTGTTGTACTCACCCCCGCGCACCGCTCCGTGCTGGCCGCGCGCGCCGCCTACTTCGAGGCCATGTTCCGCTCCTTCTCGCCGCACGACAACATCGTCAATGTAAGTGTTGTACTCACCCCCGCGCACCGCTCCGTGCTGGCCGCGCGCGCCGCCTACTTCGAGGCCATGTTCCGCTCCTTCTCGCCGCACGACAACATCGTCAATGTAAGTGTTGTACTCACCCCCGCGCACCGCTCCGTGCTGGCCGCGCGCGCCGCCTACTTCGAGGCCATGTTCCGCTCCTTCTCGCCGCACGACAACATCGTCAATGTAAGTGTTGTACTCACCCCCGCGCACCGCTCCGTGCTGGCCGCGCGCGCCGCCTACTTCGAGGCCATGTTCCGCTCCTTCTCGCCGCACGACAACATCGTCAATATACAAATCTGCGACACCGTGCCGTCGGAGGAAGCGTTCGACTCCCTGCTGCGGTACATCTACTACGGCGACACCAACATGCCTACAGAAGACTCGCTGTATCTGTTCCAAGCGCCGATATACTATGGTTTCACAAATAATCGGCTGCAAGTGTTTTGCAAGCACAACTTGCAGAGCAACGTGTCCCCAGAGAACGTGCTCGCGATCCTGCAAGCGGCCGACCGAATGCGCGCGACCGACATCAAGGAGTATGCGCTTAAAATGATCGTGCATCACTTTGGCCTTGTGGCTCGGCAGGACGCCATCAAGAACCTGGCGCAGCCGCTGCTGGTGGACATCATCTGGGCGCTGGCCGAGGAGCCGCACTTCGACTCGCCGCTGCCCGTGGCGCCGAGGTCGCTGCCGTCGTCGTCGTCCGCCGACACGCTGACGGACGACCCCGACTACTCTCGACATAGATGCGGGAAGTCCTAG
Protein Sequence: MCVVLSGTTLEQDMCVLLGGGAELADVRLRVGAAHRPAHRSVLAARAAYFEAMFRSFSPHDNIVNVSVVLTPAHRSVLAARAAYFEAMFRSFSPHDNIVNVSVVLTPAHRSVLAARAAYFEAMFRSFSPHDNIVNVSVVLTPAHRSVLAARAAYFEAMFRSFSPHDNIVNVSVVLTPAHRSVLAARAAYFEAMFRSFSPHDNIVNIQICDTVPSEEAFDSLLRYIYYGDTNMPTEDSLYLFQAPIYYGFTNNRLQVFCKHNLQSNVSPENVLAILQAADRMRATDIKEYALKMIVHHFGLVARQDAIKNLAQPLLVDIIWALAEEPHFDSPLPVAPRSLPSSSSADTLTDDPDYSRHRCGKS

Sequence clustering based on sequence similarity using MMseqs2