Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.014 1.8e+02 3.4 0.1 26 45 69 88 63 92 0.89

2 5 1.4e-05 0.18 13.0 0.1 21 46 92 117 88 123 0.88

3 5 0.00031 3.9 8.7 0.0 21 45 123 147 119 155 0.86

4 5 0.11 1.5e+03 0.5 0.0 21 44 151 174 147 179 0.86

5 5 0.00021 2.7 9.2 0.1 22 51 180 209 177 212 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.014	1.8e+02	3.4	0.1	26	45	69	88	63	92	0.89
2	5	1.4e-05	0.18	13.0	0.1	21	46	92	117	88	123	0.88
3	5	0.00031	3.9	8.7	0.0	21	45	123	147	119	155	0.86
4	5	0.11	1.5e+03	0.5	0.0	21	44	151	174	147	179	0.86
5	5	0.00021	2.7	9.2	0.1	22	51	180	209	177	212	0.86

Coding Sequence: ATGACAAAAACTTTCGAGAAATCAGAATCAGGGGATTATTTTTGTGAAGAGTGTCTTTGTGGATTTCTTTCCTTATCtgattttaataatcatatgcAAAGTTCTCATTCAAatcaacatatttataaatgtaatgaaTGTGatgagaaatttattaatcaatttaatttacaatgtcATACACTAAATAAACATCCTAAgtttaaatgtgaaatttgttttaaattattttcaacaaaatcacATTTAACAAGGCATCTTCGTTGTCACTCTGGAGAGAAACCATTTGCTTGTCCAGAATGTCCATCAACATTTACACAACaggcaaatttaaaaaaacatttaatgatACATAAGGtaCATTCTGGTGAAAAACCATTTTCTTGTCCGTATTGTCCTCTGTGTTTCAATCGTAGTGATAAtcttaaattacatattatgaCACATACTGGTGAAAAACCATTTGCATGTACTGAATGTTCATCTAGATTTAGTGATCGTAgtacattaaaaaaacatttattaattcattctggTGATAGGCCGTTTGCTTGTCCACAATGTCCAtcaaaatttaatcaacaaggacatttaaaaagacatttaatggTACATTCTGGTGAAAAACCATTTTCATGTAATCATTGTCCTTCGCGTTTTGCTAGTAAATATCATTTGGGTGTTCATTTAAGAATCCATTCACGTGGAAAACCATCGAAATTTGAGTAG
Protein Sequence: MTKTFEKSESGDYFCEECLCGFLSLSDFNNHMQSSHSNQHIYKCNECDEKFINQFNLQCHTLNKHPKFKCEICFKLFSTKSHLTRHLRCHSGEKPFACPECPSTFTQQANLKKHLMIHKVHSGEKPFSCPYCPLCFNRSDNLKLHIMTHTGEKPFACTECSSRFSDRSTLKKHLLIHSGDRPFACPQCPSKFNQQGHLKRHLMVHSGEKPFSCNHCPSRFASKYHLGVHLRIHSRGKPSKFE

Sequence clustering based on sequence similarity using MMseqs2