Klyc004942.1
Basic Information
- Insect
- Keiferia lycopersicella
- Gene Symbol
- -
- Assembly
- GCA_029255805.1
- Location
- JARACZ010000003.1:10029223-10030677[+]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 11 0.015 52 5.0 0.0 22 56 6 39 3 41 0.71 2 11 0.014 48 5.1 0.0 22 56 51 84 47 86 0.72 3 11 0.012 42 5.3 0.0 22 56 96 129 92 131 0.72 4 11 0.014 48 5.1 0.0 22 56 141 174 137 176 0.72 5 11 0.012 42 5.3 0.0 22 56 186 219 182 221 0.72 6 11 0.014 48 5.1 0.0 22 56 231 264 227 266 0.72 7 11 0.012 42 5.3 0.0 22 56 276 309 272 311 0.72 8 11 0.014 48 5.1 0.0 22 56 321 354 317 356 0.72 9 11 0.014 48 5.1 0.0 22 56 366 399 362 401 0.72 10 11 0.014 48 5.1 0.0 22 56 411 444 407 446 0.72 11 11 0.4 1.4e+03 0.5 0.4 22 44 456 477 453 480 0.49
Sequence Information
- Coding Sequence
- atgctgctcaactccacctccacccggctgatgtacaccgtgatgctgctgctggtgatggtgctcgcctgcgtcactctcgcgccggggctgcacgatgagctcaagaaggtaaggaagaaacttgcagctggcatgctgctcaactccacctccacccggctgatgtacaccgtgatgctgctgctggtgatggtgctcgcctgcgtcactctcgcgccggggctgcacgatgagctcaagaaggtaaggaagaaacttgcagctggcatgctgctcaactccacctccacccggctgatgtacaccgtgatgctgctgctggtgatggtgctcgcctgcgtcgctctcgcgccggggctgcacgatgagctcaagaaggtaaggaagaaacttgcagctggcatgctgctcaactccacctccacccggctgatgtacaccgtgatgctgctgctggtgatggtgctcgcctgcgtcactctcgcgccggggctgcacgatgagctcaagaaggtaaggaagaaacttgcagctggcatgctgctcaactccacctccacccggctgatgtacaccgtgatgctgctgctggtgatggtgctcgcctgcgtcgctctcgcgccggggctgcacgatgagctcaagaaggtaaggaagaaacttgcagctggcatgctgctcaactccacctccacccggctgatgtacaccgtgatgctgctgctggtgatggtgctcgcctgcgtcactctcgcgccggggctgcacgatgagctcaagaaggtaaggaagaaacttgcagctggcatgctgctcaactccacctccacccggctgatgtacaccgtgatgctgctgctggtgatggtgctcgcctgcgtcgctctcgcgccggggctgcacgatgagctcaagaaggtaaggaagaaacttgcagctggcatgctgctcaactccacctccacccggctgatgtacaccgtgatgctgctgctggtgatggtgctcgcctgcgtcactctcgcgccggggctgcacgatgagctcaagaaggtaaggaagaaacttgcagctggcatgctgctcaactccacctccacccggctgatgtacaccgtgatgctgctgctggtgatggtgctcgcctgcgtcactctcgcgccggggctgcacgatgagctcaagaaggtaaggaagaaacttgcagctggcatgctgctcaactccacctccacccggctgatgtacaccgtgatgttgctgctggtgatggtgctcgcctgcgtcactctcgcgccggggctgcacgatgagctcaagaaggtaaggaagaaacttgcagctggcatgctgctcaactccacctccacccggctgatgtacaccgtgatgttgctgctggtgatggtgctcgcctgcgtcactctcgcgccggggccagctgcacgatga
- Protein Sequence
- MLLNSTSTRLMYTVMLLLVMVLACVTLAPGLHDELKKVRKKLAAGMLLNSTSTRLMYTVMLLLVMVLACVTLAPGLHDELKKVRKKLAAGMLLNSTSTRLMYTVMLLLVMVLACVALAPGLHDELKKVRKKLAAGMLLNSTSTRLMYTVMLLLVMVLACVTLAPGLHDELKKVRKKLAAGMLLNSTSTRLMYTVMLLLVMVLACVALAPGLHDELKKVRKKLAAGMLLNSTSTRLMYTVMLLLVMVLACVTLAPGLHDELKKVRKKLAAGMLLNSTSTRLMYTVMLLLVMVLACVALAPGLHDELKKVRKKLAAGMLLNSTSTRLMYTVMLLLVMVLACVTLAPGLHDELKKVRKKLAAGMLLNSTSTRLMYTVMLLLVMVLACVTLAPGLHDELKKVRKKLAAGMLLNSTSTRLMYTVMLLLVMVLACVTLAPGLHDELKKVRKKLAAGMLLNSTSTRLMYTVMLLLVMVLACVTLAPGPAAR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -