Ipur019760.1
Basic Information
- Insect
- Icerya purchasi
- Gene Symbol
- -
- Assembly
- GCA_952773005.1
- Location
- OX731680.1:317524476-317525036[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.00015 5.7 9.1 0.1 21 46 23 48 16 50 0.89 2 5 8.4e-05 3.1 10.0 0.1 21 48 51 78 47 82 0.87 3 5 3.1e-05 1.1 11.4 0.1 21 51 79 109 75 110 0.87 4 5 0.0013 48 6.2 0.1 21 47 107 133 103 139 0.84 5 5 4.9e-05 1.8 10.7 0.1 22 46 136 159 131 165 0.86
Sequence Information
- Coding Sequence
- aTGTACAACGAATTGTTCCGTTACTTGCAGAGCGTGAATTTATTCACTCACGAACGAATCCACTCCGGTGAAAGGCCGTTTCGTTGCGAAGTATGCTTGAAAACGTTCACTCAGCAACCGAATCTAATGAAGCACTTGCGAATCCATACCGGCGAGAAGCCGTACATCTGTCAGATCTGCGATAAAAGTTTCACGCAACAAGCAAATCTGACCAAACATATCCGAATTCACACTGGTGAGAAGCCGTACACTTGTAACGTATGCGATAAGTCGTTCACGCAACAAGCGAATTTAACTAAACATAATCGATTACATACCGGTGAGAAACCATTTCCGTGCCAGTTTTGCTCAAAGAAATTTGCCCAGCAAGCGAATTTAGATCGGCACGAAAGAATCCATACTGGCAAGAAGCCGTACACGTGTAAAGTTTGTTGGAAAACTTTCTCGCAGCATAATAATCTTACGAAACATCAACTAACGCATAAGGCGGTACGAGAAAACTGTACCGGTAAACGTAATAAAACGGACAAAAAGGCTCGAGCTCCCTGTTTCTATTCTTAG
- Protein Sequence
- MYNELFRYLQSVNLFTHERIHSGERPFRCEVCLKTFTQQPNLMKHLRIHTGEKPYICQICDKSFTQQANLTKHIRIHTGEKPYTCNVCDKSFTQQANLTKHNRLHTGEKPFPCQFCSKKFAQQANLDRHERIHTGKKPYTCKVCWKTFSQHNNLTKHQLTHKAVRENCTGKRNKTDKKARAPCFYS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00834181;
- 90% Identity
- iTF_00834181;
- 80% Identity
- iTF_00834181;