Hvit025241.1
Basic Information
- Insect
- Homalodisca vitripennis
- Gene Symbol
- -
- Assembly
- None
- Location
- KK962890.1:286631-303468[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 7 3.4e-06 0.037 15.0 0.3 26 45 25 44 17 52 0.85 2 7 0.047 5.1e+02 1.7 0.0 21 44 48 71 45 75 0.80 3 7 0.00055 6 7.9 0.1 21 45 76 100 73 107 0.85 4 7 0.0039 43 5.2 0.1 21 47 104 130 101 135 0.80 5 7 0.0022 24 6.0 0.1 21 44 132 155 130 160 0.83 6 7 0.04 4.4e+02 2.0 0.0 21 44 160 183 157 187 0.81 7 7 0.0063 69 4.5 0.1 21 45 188 212 184 220 0.85
Sequence Information
- Coding Sequence
- atgttttgttggaaTGCTTACAGTGAACATTTAAGGACTAATTTATTGTCTAATTCAGTCGGAAAGATGTACCACTGCTCCTTATGCAGCTATGTGTGTAAAGAAAGCAGAAATTTGAAGAGGCATCTCTTGACTCACACTGGTGAGAAACCATTCAAATGTTCCTTTTGCAATTATGCTTGTACAGAAAATGGAAAGTTACAAAAACATCTATTAATGCACACAGGTGAGAAACCCTACAAGTGTTCTTTGTGCACTTATGCGTGCACAGAAAGTGGGAAATTGAAGAGGCATTTGATGACCCACACAGGGGAGAAACCATTCAAATGTTCCTTGTGCAACTATGCGTGTACAGAAAATGGGAAACTACAAAGACATTTATTAGTGCACACCGGTGAGAAGCCGTATAAGTGTTCTTTGTGTAACTATGCTTGTATAGAAAGTGGTAAGTTGAAGAGACATGTGTTTACTCACACTGGAGAAAAACCTTTTAAGTGTTCTTTCTGTAACTATGCATGTACAGAAAatggaaagttaaaaaaacatttattgaccCACACTGGTGAGAAGCCGTATGAGTGTTCTTTGTGTAGTTATTCCTGCACAGCAAGCGAAagattaaagaaacatttattaacacaTACTGGTGAAAAACCCTTTATGTGTTTCATGTGA
- Protein Sequence
- MFCWNAYSEHLRTNLLSNSVGKMYHCSLCSYVCKESRNLKRHLLTHTGEKPFKCSFCNYACTENGKLQKHLLMHTGEKPYKCSLCTYACTESGKLKRHLMTHTGEKPFKCSLCNYACTENGKLQRHLLVHTGEKPYKCSLCNYACIESGKLKRHVFTHTGEKPFKCSFCNYACTENGKLKKHLLTHTGEKPYECSLCSYSCTASERLKKHLLTHTGEKPFMCFM
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00808635;
- 90% Identity
- iTF_00808635;
- 80% Identity
- iTF_00808635;