Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.00056 6.1 7.9 0.3 14 44 23 54 17 59 0.72

2 6 0.00088 9.6 7.3 0.0 21 45 59 83 56 90 0.86

3 6 0.00031 3.4 8.7 0.1 22 44 88 110 84 116 0.87

4 6 0.0022 24 6.0 0.0 22 44 116 138 112 146 0.82

5 6 0.00096 10 7.1 0.2 23 43 145 165 140 173 0.89

6 6 0.05 5.4e+02 1.6 0.1 26 44 176 194 169 200 0.81

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.00056	6.1	7.9	0.3	14	44	23	54	17	59	0.72
2	6	0.00088	9.6	7.3	0.0	21	45	59	83	56	90	0.86
3	6	0.00031	3.4	8.7	0.1	22	44	88	110	84	116	0.87
4	6	0.0022	24	6.0	0.0	22	44	116	138	112	146	0.82
5	6	0.00096	10	7.1	0.2	23	43	145	165	140	173	0.89
6	6	0.05	5.4e+02	1.6	0.1	26	44	176	194	169	200	0.81

Coding Sequence: CTGATAGGTTACTTAAGACTTATAAGTCCTTTATTCGTAATTATGAATGTACAACCAGTGGCCCTGAAGGGTCGTTTATTGAGTGATAGTGCCCAGAAACCTTTCAAGTGTCCCGTGTGTAATTATGCATGTCAAAGAATTGGGCATCTGAGGGATCATATATTAACTCATACAGGCGAAAAACCTTACAAGTGTTTAATTTGTGAGAGTGCATTTATAACAAGTGGAGAAATAAAGAGACATCTATTAACTCATACAGACGATAAGCCTTATAGATGTTCCACATGCAACAGTACATTCAGATCtagtagtaatttaaaacacCATGTATTAACTCATATTGGTGAGAAGTCTCATAAGTGTACTATATGTGACTATACGTGCCTTAAAAGTGGAAATCTGAAGAAACACATGTTAACTCACACTGATGTAAAACCATTCAAATGTCCCAAGTGTACCTATGTATGTAGAACAAGTTGGCATCTAAAGAACCATTCATTAGTTCATACTGATGAGAAGCTTTACAAGTGTTCCACATGTACATATGCATGCAAAACAAATGGAAATCTtaagaaacatttgttaacaCACACAAGAAGGCTTGTAAGTGACCTTTGTGTAGTTAAACATGAATAA
Protein Sequence: LIGYLRLISPLFVIMNVQPVALKGRLLSDSAQKPFKCPVCNYACQRIGHLRDHILTHTGEKPYKCLICESAFITSGEIKRHLLTHTDDKPYRCSTCNSTFRSSSNLKHHVLTHIGEKSHKCTICDYTCLKSGNLKKHMLTHTDVKPFKCPKCTYVCRTSWHLKNHSLVHTDEKLYKCSTCTYACKTNGNLKKHLLTHTRRLVSDLCVVKHE

Sequence clustering based on sequence similarity using MMseqs2