Hpla008569.1
Basic Information
- Insect
- Hololepta plana
- Gene Symbol
- ZIPIC_3
- Assembly
- GCA_963695495.1
- Location
- OY968837.1:5896139-5896657[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 2.4e-05 0.17 11.7 0.0 21 44 10 33 2 41 0.86 2 4 0.028 2e+02 1.9 0.2 21 48 38 65 34 69 0.80 3 4 1.4e-06 0.01 15.6 0.1 23 44 68 89 64 93 0.90 4 4 0.0026 18 5.2 0.0 19 43 93 117 90 121 0.82
Sequence Information
- Coding Sequence
- ATGGAGAAGCACATAAGAATACATACTGGTGAAAAACCGTTCGTTTGTCCGGTTTGCGAACGCGGTTTCACTCAACGTGCAAACTTGAAAAAGCATCAGAGAACTCATACAGGCGAGAAGCCGTACGCTTGTAAATATTGTTCGCGGCGCTTTGCCCAATTgtcgaacaaacaaaaacacgAGATCTTACATAAAGGCATTAAACCGTACTCGTGTCCAATTTGTTTGGTAGCATTTACGCAACAGAGCAATCTGAAAAAACATTTGTTAACCCACAATAATTCGGAAGAAGTGAATACTTGTAAAATATGCAATAAGACATACTTTAAGAGGAAGAATTTTCTCAAACATTCTAAAGAGTGCGACGAATTGAATCGCACCAAGACCCAATTGAATTTCGCCAAGATCAATCAGCACGCCAGCAAAATGATCTCGATTAAGGCGCAAAGCTGA
- Protein Sequence
- MEKHIRIHTGEKPFVCPVCERGFTQRANLKKHQRTHTGEKPYACKYCSRRFAQLSNKQKHEILHKGIKPYSCPICLVAFTQQSNLKKHLLTHNNSEEVNTCKICNKTYFKRKNFLKHSKECDELNRTKTQLNFAKINQHASKMISIKAQS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00807836;
- 90% Identity
- iTF_00807836;
- 80% Identity
- iTF_00807836;