Basic Information

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 4.5e-10 5.5e-07 29.9 15.2 3 68 52 120 50 122 0.80

2 3 0.0019 2.3 8.7 0.5 4 20 178 194 175 197 0.84

3 3 0.00015 0.18 12.3 0.8 51 70 199 218 196 218 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	4.5e-10	5.5e-07	29.9	15.2	3	68	52	120	50	122	0.80
2	3	0.0019	2.3	8.7	0.5	4	20	178	194	175	197	0.84
3	3	0.00015	0.18	12.3	0.8	51	70	199	218	196	218	0.90

Coding Sequence: ATGACGACGACCACTTTACCGCCAATTGAGGAGCAGCAGCCCCAGCCGCATCCGTACCAGACCACCACGTTGCTCGGAGCACAGAAGGAACAGGATATCTATGAGAACTTTGCCACACCGTTGCCTGGCACTTTCCTCAATCTGCCACATGATTCGGTGCTGCTGAAGTGCCCCTCATGTGGCATCAAGGATCAGAGTGTGCTCCAGAATGATCTCAAATGGTGGGCCAGTGAGCTCAATCGCATTGTGGGCTGCCTGTTTGTgaccttctgctgctgctgctgcatggaCTACATTGTGCCCTGCAAGCAGACCGACCGCAGCCACTACTGCGGCAACTGTGGCTGCTACTTTGGACGCGCCATGAAGCGACGCGCGCCACTCAAAGTCAAATCGAACTATCCATTGGCACGCGATCGGAACAACACTGTGCAGCGTCTGCTCTcatttcatatcatatcaatTGATCAAGCGACACTCGACATGGCTGAGGAACCTGCTCCCGTTTATTTCGCTGTCGGGCCCCGCGCCCGCGAGATCACCTGCCCCTACTGCAAGACCATGGCCAAGACGCGTCTGGTCCGCTCCTGGCTGCGTTGCGGCACCAAGCGTCATCATTGTGGCGCCTGTGGTGAATATCTGGGCGTCTACAAACGCCCCCAACTCTGA
Protein Sequence: MTTTTLPPIEEQQPQPHPYQTTTLLGAQKEQDIYENFATPLPGTFLNLPHDSVLLKCPSCGIKDQSVLQNDLKWWASELNRIVGCLFVTFCCCCCMDYIVPCKQTDRSHYCGNCGCYFGRAMKRRAPLKVKSNYPLARDRNNTVQRLLSFHIISIDQATLDMAEEPAPVYFAVGPRAREITCPYCKTMAKTRLVRSWLRCGTKRHHCGACGEYLGVYKRPQL

Sequence clustering based on sequence similarity using MMseqs2