Hill002563.1
Basic Information
- Insect
- Hermetia illucens
- Gene Symbol
- -
- Assembly
- GCA_905115235.1
- Location
- NC:42166535-42174477[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.1 4.6e+02 0.6 0.0 26 44 47 65 37 69 0.86 2 5 0.0004 1.8 8.4 0.2 23 45 72 94 66 98 0.91 3 5 1.1e-05 0.047 13.4 0.1 20 48 97 124 94 129 0.86 4 5 0.0048 22 4.9 0.1 21 46 126 151 123 156 0.91 5 5 0.00012 0.52 10.1 0.1 20 48 153 180 151 184 0.87
Sequence Information
- Coding Sequence
- ATGGCGTCTCCGGCCGAAACTGGCGAGTTTAAACCGAGTTACAACTGTAGAAAATGCAAAATATCATTCTCTACAAAGCGCGAATCACTCCTTCACAAAAAGACCGTTCACGATGCTGAACCAGAGCAGGGAAAATTTCTCTGTAAAATATGTAATAAAGCGTTTGCAAATCACGGTAACATGTACCGTCATATGAAAGGACACGGTGATATACGGCCACATTCGTGTCGTATATGCGGAAAAGCATTCGCGCAAGCAGCAAACTTGAATCGACATTATTCCGTTCATAATGGAGAGCGACCGTTCTCTTGCACAGTTTGCAACAAATCCTTTACCCAACAAGGCAATCTACGGCGACATGAACTCGTTCATACAGGCGAGAAACCATTCCGGTGTAAGCGTTGCGGCCGAATGTTCTCACAGCGCATAAATCTTAAGAAACACGTTATGCTACATCAAGGCTACAGACCCTTCACATGTGAGATATGCAACAAGTCATTCCTACAGCTCCAGAACTATAAGAAGCACTTACAACGCCACGAAGAGAAAGGGATCAAAACTGAAGAAAACGATGTACTCTATGAATGTGCAATGTGTGGTGTTGTTTTTAACAACTTTGCAGATTTTCAAGGGCACGAGATATTTTGCGAAGTTGCTGGCGAGGAGCAAGTGGAAACAACAACATTCGATTTAGATGAACAGCAACAAGATGAACTGGAAATTGATCAGAAACCGATTATTTTACAACAAACAGTTACTCATATTGTCAACTCATAA
- Protein Sequence
- MASPAETGEFKPSYNCRKCKISFSTKRESLLHKKTVHDAEPEQGKFLCKICNKAFANHGNMYRHMKGHGDIRPHSCRICGKAFAQAANLNRHYSVHNGERPFSCTVCNKSFTQQGNLRRHELVHTGEKPFRCKRCGRMFSQRINLKKHVMLHQGYRPFTCEICNKSFLQLQNYKKHLQRHEEKGIKTEENDVLYECAMCGVVFNNFADFQGHEIFCEVAGEEQVETTTFDLDEQQQDELEIDQKPIILQQTVTHIVNS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00793756;
- 90% Identity
- iTF_00793756;
- 80% Identity
- iTF_00793756;