Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.1 4.6e+02 0.6 0.0 26 44 47 65 37 69 0.86

2 5 0.0004 1.8 8.4 0.2 23 45 72 94 66 98 0.91

3 5 1.1e-05 0.047 13.4 0.1 20 48 97 124 94 129 0.86

4 5 0.0048 22 4.9 0.1 21 46 126 151 123 156 0.91

5 5 0.00012 0.52 10.1 0.1 20 48 153 180 151 184 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.1	4.6e+02	0.6	0.0	26	44	47	65	37	69	0.86
2	5	0.0004	1.8	8.4	0.2	23	45	72	94	66	98	0.91
3	5	1.1e-05	0.047	13.4	0.1	20	48	97	124	94	129	0.86
4	5	0.0048	22	4.9	0.1	21	46	126	151	123	156	0.91
5	5	0.00012	0.52	10.1	0.1	20	48	153	180	151	184	0.87

Coding Sequence: ATGGCGTCTCCGGCCGAAACTGGCGAGTTTAAACCGAGTTACAACTGTAGAAAATGCAAAATATCATTCTCTACAAAGCGCGAATCACTCCTTCACAAAAAGACCGTTCACGATGCTGAACCAGAGCAGGGAAAATTTCTCTGTAAAATATGTAATAAAGCGTTTGCAAATCACGGTAACATGTACCGTCATATGAAAGGACACGGTGATATACGGCCACATTCGTGTCGTATATGCGGAAAAGCATTCGCGCAAGCAGCAAACTTGAATCGACATTATTCCGTTCATAATGGAGAGCGACCGTTCTCTTGCACAGTTTGCAACAAATCCTTTACCCAACAAGGCAATCTACGGCGACATGAACTCGTTCATACAGGCGAGAAACCATTCCGGTGTAAGCGTTGCGGCCGAATGTTCTCACAGCGCATAAATCTTAAGAAACACGTTATGCTACATCAAGGCTACAGACCCTTCACATGTGAGATATGCAACAAGTCATTCCTACAGCTCCAGAACTATAAGAAGCACTTACAACGCCACGAAGAGAAAGGGATCAAAACTGAAGAAAACGATGTACTCTATGAATGTGCAATGTGTGGTGTTGTTTTTAACAACTTTGCAGATTTTCAAGGGCACGAGATATTTTGCGAAGTTGCTGGCGAGGAGCAAGTGGAAACAACAACATTCGATTTAGATGAACAGCAACAAGATGAACTGGAAATTGATCAGAAACCGATTATTTTACAACAAACAGTTACTCATATTGTCAACTCATAA
Protein Sequence: MASPAETGEFKPSYNCRKCKISFSTKRESLLHKKTVHDAEPEQGKFLCKICNKAFANHGNMYRHMKGHGDIRPHSCRICGKAFAQAANLNRHYSVHNGERPFSCTVCNKSFTQQGNLRRHELVHTGEKPFRCKRCGRMFSQRINLKKHVMLHQGYRPFTCEICNKSFLQLQNYKKHLQRHEEKGIKTEENDVLYECAMCGVVFNNFADFQGHEIFCEVAGEEQVETTTFDLDEQQQDELEIDQKPIILQQTVTHIVNS

Sequence clustering based on sequence similarity using MMseqs2