Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 3.6e-17 1.3e-14 54.9 0.2 4 106 183 279 180 283 0.89

2 3 2.9 1e+03 0.5 0.0 81 108 286 313 280 315 0.80

3 3 9 3.2e+03 -1.1 0.0 62 79 330 347 325 352 0.78

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	3.6e-17	1.3e-14	54.9	0.2	4	106	183	279	180	283	0.89
2	3	2.9	1e+03	0.5	0.0	81	108	286	313	280	315	0.80
3	3	9	3.2e+03	-1.1	0.0	62	79	330	347	325	352	0.78

Coding Sequence: ATGGATTCCGAATTTTTTGTAAACAAGTGGCAACAGAAGGGCAATGTCGGCCATGTGTCTCCTATCTTCCACTGCCAAACAGAAAACGCAACAGATTTGTGTATCTACAACATTTCAGCAAAGCTGAAGCACAGCAGTAATTATGACATAGGTGGTACATATTCAGATGACCAGCCTGACTTCTGGTTTTATTACACCACTTCCATGACACATGGTTACAACTTCCTGCTTAATTTGTTTGTTCTCCCGCGGAAGCCAGCATGCTTTACACTTACAGTCCCTAAAAAGAAGCTGTTGAGCACACCTGTCACCAATAACAATGGCCTCAAATTTGTCATCTTTTATGGCCCCGAAACTGAGAGCACTTTTAGAACAAACCAGAATGACCAGTATGTATATGTCAAAACATTTCTATTCAATTCCGATGATGTCACTGCTCTAGAGAAGTGCATACTCTACATGCCTATAAAAATTCAAGTGCATTCAAAGATCAAATTCGACCCTATTGTCGTGAAGAGGATAAAGCTCTCTCATGACCTCAGCTCTCTAATGACAGACAAAGCCAGTGCAGATATCTGGATTAAGTCTGCCTCTGGTAAGAAGTATCAGGCACATAAAATCCTGTTGGCAGCTCACAGCCCATTACTGAGGAACATGTTGAAGAATTCTGACAAGGAAATATCGCTGGATGTCTCTGATGATGCCATAGAAATTATGCTGGAGTTTCTGTACACAGGTACTTTAGCAAACCTGGACAAACTCAACTGTCTAGTGCTCTTAGACACAGCTGAGAAACTGAGCCTGACAAACTTGGTCAGATTGGCTCAGCAGGTACTTGGAGATGAAGTGAAAGTAGAAAATGCCATAGGCATAGCATTACAAGCAAAGAAATATAAATTAGATAGTCTCATGACGAAAGTGTTTGAGTATGTAAGGAATAATCCTAAAGTACTAAATAGTGAAGGATGGCAGAAGCTGGAAGACATTGAATTGATCAAGCAAATGCTTCAATATATTCATCATCCAACAACTGACTCAAACAAACAAATTAAAGTTGATTAA
Protein Sequence: MDSEFFVNKWQQKGNVGHVSPIFHCQTENATDLCIYNISAKLKHSSNYDIGGTYSDDQPDFWFYYTTSMTHGYNFLLNLFVLPRKPACFTLTVPKKKLLSTPVTNNNGLKFVIFYGPETESTFRTNQNDQYVYVKTFLFNSDDVTALEKCILYMPIKIQVHSKIKFDPIVVKRIKLSHDLSSLMTDKASADIWIKSASGKKYQAHKILLAAHSPLLRNMLKNSDKEISLDVSDDAIEIMLEFLYTGTLANLDKLNCLVLLDTAEKLSLTNLVRLAQQVLGDEVKVENAIGIALQAKKYKLDSLMTKVFEYVRNNPKVLNSEGWQKLEDIELIKQMLQYIHHPTTDSNKQIKVD

Sequence clustering based on sequence similarity using MMseqs2