Hfuc014149.1
Basic Information
- Insect
- Hemaris fuciformis
- Gene Symbol
- foxa2
- Assembly
- GCA_907164795.1
- Location
- OU015438.1:1391421-1397839[-]
Transcription Factor Domain
- TF Family
- Fork_head
- Domain
- Fork_head domain
- PFAM
- PF00250
- TF Group
- Helix-turn-helix
- Description
- The fork head domain is a conserved DNA-binding domain (also known as a winged helix) of about 100 amino-acid residues. Drosophila melanogaster fork head protein is a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [1]. Instead, it contains a distinct type of DNA-binding region, containing around 100 amino acids, which has since been identified in a number of transcription factors (including D. melanogaster FD1-5, mammalian HNF-3, human HTLF, Saccharomyces cerevisiae HCM1, etc.). This is referred to as the fork head domain but is also known as a 'winged helix' [1, 2, 3]. The fork head domain binds B-DNA as a monomer [2], but shows no similarity to previously identified DNA-binding motifs. Although the domain is found in several different transcription factors, a common function is their involvement in early developmental decisions of cell fates during embryogenesis [3].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 1.4e-08 2e-05 25.1 0.0 1 35 65 97 65 107 0.87 2 2 3.3e-16 4.9e-13 49.5 0.0 33 82 128 174 125 178 0.91
Sequence Information
- Coding Sequence
- ATGTCAGCCAAAAATAGCGACAGGACCAAGTGGAGAAGGAAAAAATCGCCCAAAAACTCAGTGGACGAGGACAATGACTGCGCCAGCCTCGCCTGGCTCCTAAACTTCAGGCTAGACGAGATTGTGAACGTCAAAGTGCCTGACGACGAGGTGGAAGAACCTAAAGAAGTCCCAGAGAGTGCGCCGGTGTCGAAAAAGCCGCCTTATACGTATCCCGAATTGATTGAGAGAGCACTGAGGGAAAAGGGGGAGTTGACAGTGTCAGCTATATACCAGTGGATATCTGCACAGCAGGTGCAAAACTTTACCCGCAAATCTGTTTTGTTTACCCCAAATGTTTACGTCGCGCCGGTGCGGTGGTTGCGCCGTCCCATCGCCGCCCGTGACCGTTTCCCATTCTACAAAGCGAATGACGAGCGCTGGAAGAACTCGGTGCGACACAACCTGTCCATCAACCCTCACTTTCGGAAGGGAGCCAGAGCTCCCCAGGGCGCCGGCCACCTTTGGTCTCTCGCTGCCAATGCCATAGACCTCCTACCTTTGAGGAACATCCCTGTACATGACGAGAACGTGGTTGAAATCAACCAGGGCACGAAGATCATCGGTTTTCCTAAGGTGATCGTGCTGGACGAGGCAGCCATCGCAGCCGCCAGCATCCTACCAGATCAAGACATTTTTAGCGGTAGTACAATGTTCCTGAATCCAGTGTCTACGGAGCAGGTCGTCAGAGAATGCGGGCTCATCACTGTCGACTAG
- Protein Sequence
- MSAKNSDRTKWRRKKSPKNSVDEDNDCASLAWLLNFRLDEIVNVKVPDDEVEEPKEVPESAPVSKKPPYTYPELIERALREKGELTVSAIYQWISAQQVQNFTRKSVLFTPNVYVAPVRWLRRPIAARDRFPFYKANDERWKNSVRHNLSINPHFRKGARAPQGAGHLWSLAANAIDLLPLRNIPVHDENVVEINQGTKIIGFPKVIVLDEAAIAAASILPDQDIFSGSTMFLNPVSTEQVVRECGLITVD
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00819877; iTF_00427916; iTF_00428821; iTF_00818971; iTF_01429755; iTF_00290486;
- 90% Identity
- -
- 80% Identity
- -