Hsar018977.1
Basic Information
- Insect
- Heliconius sara
- Gene Symbol
- Ssb-c31a_1
- Assembly
- GCA_917862395.2
- Location
- OU860798.1:15815454-15815956[+]
Transcription Factor Domain
- TF Family
- PC4
- Domain
- PC4 domain
- PFAM
- PF02229
- TF Group
- Unclassified Structure
- Description
- This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 6e-28 1.4e-23 82.5 0.8 1 51 43 93 43 94 0.96
Sequence Information
- Coding Sequence
- atgcccaaaaataagaaaaaagctGAGAGCTCTAGTAGCGATAGTGATGATGGCCCTGTAGATCGAAATCCACCGCCCGAAAAAAAAGCGAAAATGGGAGCTAGAACTGATGATAAAGAGCCAACTTGGGTTCTAGAAggaaaaaaacttgtaaaagTCCGTGAATTCAAAGGAaaagtttatatagatataagagaattttatgaaaaaaatggtGAATTACTACCAGGAAAAAAAGGAATCAGTTTGACCCCAGATATGTGGAGAAAACTGTTATCCCTGGGAGATGAAATTAATGAAACTGTCAGTTCTATgtga
- Protein Sequence
- MPKNKKKAESSSSDSDDGPVDRNPPPEKKAKMGARTDDKEPTWVLEGKKLVKVREFKGKVYIDIREFYEKNGELLPGKKGISLTPDMWRKLLSLGDEINETVSSM
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01076532;
- 90% Identity
- iTF_00781858; iTF_00776742; iTF_00896840; iTF_00779530; iTF_00621263; iTF_00776048; iTF_00775281; iTF_00778035; iTF_00774517; iTF_00780279; iTF_00777401; iTF_00778781; iTF_00781054; iTF_01017762; iTF_01018594; iTF_00213476; iTF_00248112; iTF_00212497; iTF_00723094; iTF_00247224; iTF_00458077; iTF_00159871; iTF_00960197; iTF_00958696; iTF_00959435; iTF_00457261; iTF_00843566; iTF_00695632; iTF_00421394; iTF_00419786; iTF_00986130; iTF_00461591; iTF_01181916; iTF_00420575; iTF_00419018;
- 80% Identity
- iTF_00781858;