Hsar005076.1
Basic Information
- Insect
- Heliconius sara
- Gene Symbol
- Runx1
- Assembly
- GCA_917862395.2
- Location
- OU860784.1:7883980-7894509[+]
Transcription Factor Domain
- TF Family
- Runt
- Domain
- Runt domain
- PFAM
- PF00853
- TF Group
- Beta-Scaffold Factors
- Description
- The AML1 gene is rearranged by the t(8;21) translocation in acute myeloid leukemia [1]. The gene is highly similar to the Drosophila melanogaster segmentation gene runt and to the mouse transcription factor PEBP2 alpha subunit gene [1]. The region of shared similarity, known as the Runt domain, is responsible for DNA-binding and protein-protein interaction.In addition to the highly-conserved Runt domain, the AML-1 gene product carries a putative ATP-binding site (GRSGRGKS), and has a C-terminal region rich in proline and serine residues. The protein (known as acute myeloid leukemia 1 protein, oncogene AML-1, core-binding factor (CBF), alpha-B subunit, etc.) binds to the core site, 5'-pygpyggt-3', of a number of enhancers and promoters.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.3e-49 3.8e-46 156.3 0.0 7 101 33 126 27 148 0.90
Sequence Information
- Coding Sequence
- ATGCACTTGCCGTACGAGTCCAGGGGCCGTCGGCGCCGCGAGATGGCCGAGCTCGAGCCCTGGTGGCTCCAGTCCATCATCGACGAAACGCTGGGCGAACATCCTGACCTCGTACGGACCGGCAGTCCAGACTATATGTGCTCGCAGCTACCACTACACTGGCGCTCCAACAAGACACTGCCGGGTGGTTTCAAGGTGGTGGCGTTGGGCGACGTGCTCGACGGGACCCAGGTGACCGTCAGAGCGGGCAACGATGAGAACTGCTCCGCGGAACTAAGGAATAATACAGCTGTAATGAAGAATAGAGTCGCCAAGTTCAATGATCTAAGATTTGTCGGTCGAAGTGGTAGAGAACCTGAGCTCTTGCTCACACAATCACcacagtggaaatcgaaaccacaagaATCATCAAAAACTATAAATAGACATACTACCTGTCCTATTCAGTCAAAATATTTAcgttaa
- Protein Sequence
- MHLPYESRGRRRREMAELEPWWLQSIIDETLGEHPDLVRTGSPDYMCSQLPLHWRSNKTLPGGFKVVALGDVLDGTQVTVRAGNDENCSAELRNNTAVMKNRVAKFNDLRFVGRSGREPELLLTQSPQWKSKPQESSKTINRHTTCPIQSKYLR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00780045;
- 90% Identity
- iTF_00777781;
- 80% Identity
- -