Basic Information

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 6.5e-10 3.9e-06 28.3 3.0 3 38 27 62 25 67 0.88

2 3 0.0015 8.7 7.9 1.3 8 35 62 90 60 107 0.86

3 3 1.4 8.2e+03 -1.6 0.0 9 17 102 110 94 111 0.76

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	6.5e-10	3.9e-06	28.3	3.0	3	38	27	62	25	67	0.88
2	3	0.0015	8.7	7.9	1.3	8	35	62	90	60	107	0.86
3	3	1.4	8.2e+03	-1.6	0.0	9	17	102	110	94	111	0.76

Coding Sequence: ATGAATCAATCGATGTCGACGGCGATTGCCTCGGCGCCTGTTGTCAGACCCGGGATAGCTCCGCTGCTTGGCCCCGACAACACAAACTGCGACTGCCCGTTCTGTAACGCCAGCATCAAGACCGCGGTGCGGTACAGCACCACATCGCGTACGCACATCGCCGCCGCGCTGTGGTGTTTGGCTTGTTCTGTACCTAACGCCAGCATCAAGACCGCGGTGCGGTACAGCACCACATCGCGTACGCACATCGCCGCCCAATGTGGTGTTTGGCTTGGTAATTCCTATCCTAGTTACCTTCGTTACCAGCACTGTAACGCCAATATTAAGACCTTAGCACCGGGACCAAGCACTTAA
Protein Sequence: MNQSMSTAIASAPVVRPGIAPLLGPDNTNCDCPFCNASIKTAVRYSTTSRTHIAAALWCLACSVPNASIKTAVRYSTTSRTHIAAQCGVWLGNSYPSYLRYQHCNANIKTLAPGPST*

Sequence clustering based on sequence similarity using MMseqs2