Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.073 6.7e+02 2.8 0.1 20 35 33 48 22 58 0.72

2 8 0.35 3.2e+03 0.6 0.0 21 31 62 72 54 84 0.79

3 8 0.00016 1.5 11.3 0.1 17 52 86 121 82 123 0.87

4 8 1.5 1.4e+04 -1.4 0.0 22 37 119 134 116 148 0.56

5 8 0.056 5.1e+02 3.2 0.1 21 52 149 180 134 182 0.82

6 8 0.0018 16 8.0 0.0 21 48 177 204 169 210 0.84

7 8 0.33 3.1e+03 0.7 0.0 23 43 207 227 203 232 0.85

8 8 8.1e-05 0.75 12.2 0.1 21 45 233 257 222 259 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.073	6.7e+02	2.8	0.1	20	35	33	48	22	58	0.72
2	8	0.35	3.2e+03	0.6	0.0	21	31	62	72	54	84	0.79
3	8	0.00016	1.5	11.3	0.1	17	52	86	121	82	123	0.87
4	8	1.5	1.4e+04	-1.4	0.0	22	37	119	134	116	148	0.56
5	8	0.056	5.1e+02	3.2	0.1	21	52	149	180	134	182	0.82
6	8	0.0018	16	8.0	0.0	21	48	177	204	169	210	0.84
7	8	0.33	3.1e+03	0.7	0.0	23	43	207	227	203	232	0.85
8	8	8.1e-05	0.75	12.2	0.1	21	45	233	257	222	259	0.89

Coding Sequence: ATGCGTCGTCACGTAGGCGAAAAGAAACATCTATGTACAGTTTGTGGAAAACGATTTTACGAAAGTAATGTCCTAACCACTCACATGAGAAGCCACACTGGAGAACGGCCATTTACCTGCTCTTTATGCCCTAAAAAATTTAGTACAAGCAGTCAACTTGATGTCCATTCCAAAACTCATTCCGGGGAGAAGAAACATACCTGTGATATTTGCAATATGTCCTTTGCTGAACGATGGTACTTAAACGTTCACAAAAGACGACATACTGGAGAACGGCCGTATACATGTAACATTTGCGACAAAAAATTCTCCCACGCGGGAACTTTGCGAACGCATCTTAGAATACATACTGGCGAAAAGCCCTACAAATGTAAATTCTGCGAAGAGAAGTTTATAACAGCGGAAAAAGCAAGAAATCATATGCGAAAACACACGGGACAGAAACGCGAAATGAAAGCAATTTGTACGGCGTGTGGTAAGCAATGCAGTAATTCTTCTGATCTTAAAATTCATATGAGATTGCATAGTGGCGAAAAACCgtttgtatgtaaaatttgtggTAAGGCATTTGTAGTTTCTGGTAACTTAAACGCTCATTTACGAATCCATTCGGGGGTAAGACCGTTTGTTTGTACAATTTGTGGTAAAGGGTTCAAGGAATCATCAACTTTGAAGATTCATAACAGAATACACACAGGGGAAAGaccattttcatgtaaaatttgTCAGAAAACATTCACACAATCGGGGGCTTTACGGACACATTTAAAaacacattaa
Protein Sequence: MRRHVGEKKHLCTVCGKRFYESNVLTTHMRSHTGERPFTCSLCPKKFSTSSQLDVHSKTHSGEKKHTCDICNMSFAERWYLNVHKRRHTGERPYTCNICDKKFSHAGTLRTHLRIHTGEKPYKCKFCEEKFITAEKARNHMRKHTGQKREMKAICTACGKQCSNSSDLKIHMRLHSGEKPFVCKICGKAFVVSGNLNAHLRIHSGVRPFVCTICGKGFKESSTLKIHNRIHTGERPFSCKICQKTFTQSGALRTHLKTH

Sequence clustering based on sequence similarity using MMseqs2