Hhal000533.1
Basic Information
- Insect
- Halyomorpha halys
- Gene Symbol
- -
- Assembly
- GCA_000696795.2
- Location
- NW:15026-22515[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 1.7e-06 0.0017 18.0 0.4 18 50 3 35 1 39 0.89 2 4 0.3 2.9e+02 1.2 0.2 26 48 40 62 36 64 0.75 3 4 0.0012 1.1 8.9 0.3 17 48 60 91 56 95 0.87 4 4 0.015 14 5.4 0.2 22 49 94 121 92 125 0.85
Sequence Information
- Coding Sequence
- atggccCGTCATACCGGTGAAAAGCCCTGTCAGTGCCCTCATTGCGATTATAAATCAGTGGAATCTGGAAATATGAAAAGGCATATAATGATTCGTCATGCAGCTGCAAAGTCCCATCATTGtccttattgtaattataagtcAGTAACATTTGACAGTATGAAAAGGCAcataatggcccgtcatacaGGGGAAAAGCCCTGTCAATGCccttattgtgattataaatcagtaggaTCTGGAAGTATGAAAACGCATATAATGATTCGTCATACAGGTGAAAAGTCCCATCATTGTCCTCATTGTAATTATAAGTCAGTAACATCTGACAGTATGAAAAGGCAcataatggcccgtcatacaGGTGAAAAATCCTATCAATGttctcattgtgattataaatcagtaacaTCTGGAGGTGGACTTACTCatgtaaaagaagaagaagaactgCTTATTCCAGATGAAGGTGAGaaacatttatcttattaa
- Protein Sequence
- MARHTGEKPCQCPHCDYKSVESGNMKRHIMIRHAAAKSHHCPYCNYKSVTFDSMKRHIMARHTGEKPCQCPYCDYKSVGSGSMKTHIMIRHTGEKSHHCPHCNYKSVTSDSMKRHIMARHTGEKSYQCSHCDYKSVTSGGGLTHVKEEEELLIPDEGEKHLSY
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00764261;
- 90% Identity
- iTF_00764261;
- 80% Identity
- iTF_00764261;