Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.0081 7.7 6.2 0.2 18 48 3 33 1 36 0.86

2 7 5.8e-05 0.056 13.1 0.2 18 48 32 62 29 63 0.84

3 7 0.00013 0.12 12.0 0.1 18 48 61 91 59 93 0.87

4 7 5.7e-05 0.055 13.1 0.4 20 49 92 121 88 125 0.88

5 7 0.01 9.9 5.9 0.3 18 49 119 150 117 154 0.84

6 7 0.032 31 4.3 0.7 18 45 148 175 144 182 0.76

7 7 0.042 40 3.9 0.2 20 45 179 204 173 208 0.78

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.0081	7.7	6.2	0.2	18	48	3	33	1	36	0.86
2	7	5.8e-05	0.056	13.1	0.2	18	48	32	62	29	63	0.84
3	7	0.00013	0.12	12.0	0.1	18	48	61	91	59	93	0.87
4	7	5.7e-05	0.055	13.1	0.4	20	49	92	121	88	125	0.88
5	7	0.01	9.9	5.9	0.3	18	49	119	150	117	154	0.84
6	7	0.032	31	4.3	0.7	18	45	148	175	144	182	0.76
7	7	0.042	40	3.9	0.2	20	45	179	204	173	208	0.78

Coding Sequence: atggcccgtcacACAGGAGAAAAGCCCCATCagtgtcctcactgtgattataaatctgTTACATCTGAAGCAATGAAAAGTCATATTATGGCCCGTCACACAGGTGAGAAGCCCCATCAATGTCcttactgtgattataaatcagtaagaTCTAAAAATCTGGAAAAGCATGTAATGGACCGTCACACAAGTGAGAAGCCCtatcaatgtcctcactgtgattataaatcagtagaatctaaaaatctagaaaaacaTGTTATGTCCAGTCACATAAGTGAGAAGCCATGCCAATGTCcttactgtgattataaatcagttcagTCTATAAGcatgaaaaaacatattatggCCCGCCACACAGGTGAGAAGCCCTATCAGTGTCcttactgtgattataaatcagtccAATTTGTAAGTATGAAAAGTCATATCATGGCCCGTCACACAGGTGAGAAACCCCATCAATGTCCTTactgtgaatataaatcagtaacCTCTGGATGTTTGAAAAGTCATATAATGAGCCATCACACAGGTGAGAAGACGCATCAATGTCCTcaatgtgattataaatcagtaatatctggaaatataaaaagacaTATAATGGCTCTTCACACAGGTTAG
Protein Sequence: MARHTGEKPHQCPHCDYKSVTSEAMKSHIMARHTGEKPHQCPYCDYKSVRSKNLEKHVMDRHTSEKPYQCPHCDYKSVESKNLEKHVMSSHISEKPCQCPYCDYKSVQSISMKKHIMARHTGEKPYQCPYCDYKSVQFVSMKSHIMARHTGEKPHQCPYCEYKSVTSGCLKSHIMSHHTGEKTHQCPQCDYKSVISGNIKRHIMALHTG

Sequence clustering based on sequence similarity using MMseqs2