Gmor003171.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Glossina morsitans
Gene Symbol
bs
Assembly
None
Location
scf7180000646131:3019-12707[-]

Transcription Factor Domain

TF Family
SRF
Domain
SRF domain
PFAM
PF00319
TF Group
Helix-turn-helix
Description
Serum response factor (SRF) is a ubiquitous nuclear protein important for cell proliferation and differentiation. SRF function is essential for transcriptional regulation of numerous growth-factor-inducible genes, such as c-fos oncogene and muscle-specific actin genes. A core domain of around 90 amino acids is sufficient for the activities of DNA-binding, dimerisation and interaction with accessory factors. Within the core is a DNA-binding region, designated the MADS box [2], that is highly similar to many eukaryotic regulatory proteins: among these are MCM1, the regulator of cell type-specific genes in fission yeast; DSRF, a Drosophila trachea development factor; the MEF2 family of myocyte-specific enhancer factors; and the Agamous and Deficiens families of plant homeotic proteins. In SRF, the MADS box has been shown to be involved in DNA-binding and dimerisation [1]. Proteins belonging to the MADS family function as dimers, the primary DNA-binding element of which is an anti-parallel coiled coil of two amphipathic α-helices, one from each subunit. The DNA wraps around the coiled coil allowing the basic N-termini of the helices to fit into the DNA major groove. The chain extending from the helix N-termini reaches over the DNA backbone and penetrates into the minor groove. A 4-stranded, anti-parallel β-sheet packs against the coiled-coil face opposite the DNA and is the central element of the dimerisation interface. The MADS-box domain is commonly found associated with K-box region see (IPR002487).
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 4.9e-11 2e-07 29.8 0.1 23 48 6 31 5 31 0.98

Sequence Information

Coding Sequence
ATGGTGTCATCCGTGGCATATGAACTGTCGACGTTGACGGGAACCCAAGTAATGCTGTTAGTTGCCTCGGAAACAGGACATGTTTATACGTTTGCGACGCGTAAACTTCAACCTATGATTACGTCAGAAGCTGGTAAGCAGCTCATTCAAACCTGTCTGAATTCACCAGATCCGCCCAGCGTCGGTGGCGGCGATCAGCGTATGTCTGCGACTGGATTCGAAGAAACCGAACTCAGTTACAACATTGCCGATGAGGACTCAAAAGTAAGACAATTAATTTATGGTCATCATGGTCACGCTCATCTCGGTCATCCGCAAGCCCCTGCCTCGCATTACGGTCTAGATCAAAGTATAATGCAATCGCCATATAGCGGCGGTCAACCGTCACCATTATCCCATTCGCAGGCTTATGCAGCACATGGGCATCCCCATCATTCCCATGTGCCGCATGTGCCTCATTCCACACACTCTcatatgtcccatacgcatacgcagcggtaa
Protein Sequence
MVSSVAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMITSEAGKQLIQTCLNSPDPPSVGGGDQRMSATGFEETELSYNIADEDSKVRQLIYGHHGHAHLGHPQAPASHYGLDQSIMQSPYSGGQPSPLSHSQAYAAHGHPHHSHVPHVPHSTHSHMSHTHTQR