Basic Information

Transcription Factor Domain

TF Family: CSL
Domain: BTD domain
PFAM: PF09270
TF Group: Beta-Scaffold Factors
Description: Members of this family of DNA binding domains adopt a beta-trefoil fold, that is, a capped beta-barrel with internal pseudo threefold symmetry. In the DNA-binding protein LAG-1, it also is the site of mutually exclusive interactions with NotchIC (and the viral protein EBNA2) and co-repressors (SMRT/N-Cor and CIR) [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 0.77 5.1e+03 -2.3 0.1 58 75 19 37 16 51 0.64

2 2 1.3e-23 8.4e-20 71.2 0.0 1 54 62 115 62 123 0.92

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	0.77	5.1e+03	-2.3	0.1	58	75	19	37	16	51	0.64
2	2	1.3e-23	8.4e-20	71.2	0.0	1	54	62	115	62	123	0.92

Coding Sequence: ATGTTTTATGGTAACGGTCACGATATTGGAGTTTTCAATTCAAAGCGCATTAAGGTGATTTCGAAATCTTCGAAAAAGAAACAGTCATTAAAAAGTGCTGACTTATGTATAGCTAGCCGTACAAATGTGGCTCTATTTAATCGTTTACGCTCACAAACGGTATCCACACGTTACCTGCATGTTGAAAATGGTCATTTTCATGCGTCTTCGACGCAATGGGCAGCCTTTACCATTCATATACTGGACGATAATGAATCAGAATCGGAAGATTTTAATGTTCGTGAAGGTTATATACATTATGGTGCTACAGTGATATTGGTGTGTTCTGTAACTGGTATTTGCAATGCACCTAAATTAAACCAATCAGCTGAGAGTTTATTAGCTGGCAGTTTGTCAATGGCTTTAGACTCACGAAATAACAATCGTCGGAAGATTAATCGGTTTAGATCTTATGAGTATTGGTATGGTTTAATTTCGTACATCTTTAAATCTACAAATATGAGTAATTGCCAAGACGTCTATTGCATCTGTAATTGCAACAAAAATAATACATCGCTGCACAACAGTACAAAAAATAGTATACATACATTCGAAAAGTATTTTCATTaa
Protein Sequence: MFYGNGHDIGVFNSKRIKVISKSSKKKQSLKSADLCIASRTNVALFNRLRSQTVSTRYLHVENGHFHASSTQWAAFTIHILDDNESESEDFNVREGYIHYGATVILVCSVTGICNAPKLNQSAESLLAGSLSMALDSRNNNRRKINRFRSYEYWYGLISYIFKSTNMSNCQDVYCICNCNKNNTSLHNSTKNSIHTFEKYFH

Sequence clustering based on sequence similarity using MMseqs2