Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.00072 3.5 7.5 0.0 17 52 39 74 34 76 0.85

2 5 0.00023 1.1 9.1 0.1 23 45 73 95 69 98 0.89

3 5 0.0023 11 5.9 0.2 20 44 98 122 94 130 0.85

4 5 0.0089 43 4.0 0.1 21 52 127 158 124 159 0.87

5 5 0.0021 10 6.1 0.0 23 47 157 180 154 186 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.00072	3.5	7.5	0.0	17	52	39	74	34	76	0.85
2	5	0.00023	1.1	9.1	0.1	23	45	73	95	69	98	0.89
3	5	0.0023	11	5.9	0.2	20	44	98	122	94	130	0.85
4	5	0.0089	43	4.0	0.1	21	52	127	158	124	159	0.87
5	5	0.0021	10	6.1	0.0	23	47	157	180	154	186	0.85

Coding Sequence: ATGGCTACTCCCGAGGAATTTGACGAGACGGTTCCTGTGGCGCCGATATATAGCTGTAAACGATGCAGCAAGATATTTCCTTGCAAACGTGATCAATTGTTGCACAAAAAGGAAGTGCATTCTCAGAATAAATCATCGTATGAATGCAAGTTATGCGGAAAATTCTTTTGCAACAGCGGTAACTTGGAGCGTCACATGAAGGTACACAACAATGTTCGTCCGTTTGTATGTCGCATTTGTGGTAAAGCATTTGCTCAATCGGTGAACTTGACTCGCCACTATTCGGTGCATAATGGTGAGCGTCCGTATCAATGTAACTTTTGCACCAAAACTTTTACACAACAAAGTAATATGACGCGCCATCAACTAACACATACCGGTGAGAAACCATTCCGCTGTAAACGTTGTGGCCGTTACTTTTCACAACGTGTCAATCTCAAAAAGCATATAATGGGTCACTTAAATGCCAAACCTTATGCCTGCAAAATCTGCCAGAAAGCTTTCATACAAATGGGTAATTTTAAGAAGCATTTGCTAACTCATATAAAGGATGGAGTGGACATCGATATTAAGGCTACTTTGGCTGAAGCTCAAGCGCAAGCTCACCAATGTCTGGAATTAGCTGATGACCAACCAGTCGGTTTTGAATGTGCTGTCTGTCGTTTGGTTTTTAATAATTTTACGGATTTTGAAATGCACGAAAATGAATGTAACGTCCGTGCCCAAAATATTGACGATATCGACGGTGAGCACGTTACCCATGAAGTAGTCGTACAGGATATTGAAGAACAAGTTGAAGAACATGTTATAACATCGATAGAAGATCAGAATCAATTTGCTCCTTTAAAGTATAGTGTATCACAATTGGATACTCATGAAATTATAATTGAAACAAGTCGATAA
Protein Sequence: MATPEEFDETVPVAPIYSCKRCSKIFPCKRDQLLHKKEVHSQNKSSYECKLCGKFFCNSGNLERHMKVHNNVRPFVCRICGKAFAQSVNLTRHYSVHNGERPYQCNFCTKTFTQQSNMTRHQLTHTGEKPFRCKRCGRYFSQRVNLKKHIMGHLNAKPYACKICQKAFIQMGNFKKHLLTHIKDGVDIDIKATLAEAQAQAHQCLELADDQPVGFECAVCRLVFNNFTDFEMHENECNVRAQNIDDIDGEHVTHEVVVQDIEEQVEEHVITSIEDQNQFAPLKYSVSQLDTHEIIIETSR

Sequence clustering based on sequence similarity using MMseqs2