Basic Information

Transcription Factor Domain

TF Family: DACH
Domain: DACH domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This family of proteins includes transcription factors involved in the regulation of organogenesis. Members of this family appear to regulate the SIX1, SIX6, and possibly SIX5 genes, influencing myogenesis and the proliferation of precursor cells in myoblasts. They are known to act as corepressors or coactivators in these processes, depending on their interaction with other proteins such as EYA3, CREBBP, NCOR1, TBL1, HDAC1, and HDAC3. These proteins are also implicated in the repression of cyclin-dependent kinase inhibitors, including the p27Kip1 promoter, which is key in cell cycle regulation. Some family members inhibit TGF-beta signaling through interactions with SMAD4. They are characterized by a conserved DNA-binding domain known as the DACHbox-N or DD1 domain, which is structurally similar to the forkhead/winged helix domain and is responsible for their DNA-binding activity.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 1.9e-14 1.8e-10 41.7 3.4 104 162 90 150 66 160 0.82

2 2 0.052 5e+02 1.2 0.1 89 106 209 226 205 242 0.61

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	1.9e-14	1.8e-10	41.7	3.4	104	162	90	150	66	160	0.82
2	2	0.052	5e+02	1.2	0.1	89	106	209	226	205	242	0.61

Coding Sequence: ATGCTCGGACTCGATGGTCCGACGAATTTTCCACTGAACGGATCTTTGGACGTAGACCTTTGTATTGACGAGAAATTAACGTACGGACCTTTCTATCCTAATTTTGTTAACAAAGTAATTATGTACGGTCGTGTAAATAATATACCTTTTGACATTGTGGCTAACGGTGTAGACCTTAATGAAGTTGATAAACAGACGACGACGGTGGACGGTGCAAAAACTGTATTGAGAAATATCAGACAAAATCAAGATCTTAATTTGATATTGATGTACCAAAAACGGCTAAAGAAGGAGAGAAAACAACGGCAAATGATCCAGGAGCAGCTTGAACTAGAACTCAAGAGACGACAGAAAGTAGAAGAGGCTCTCAAACAGTCCGGAGCACCCTCCGAAATACTCAGAATCGTAACTGAGAACCTAACCCCGTCATCGCAAGAGACGCCGCGCTCGGAGCGGGAGAATGGGTCAGAACGGGAGAGCAAGCCCCCCAGTGCTGAGCCCCCGTCAGCATCACCTCCCTTCCAGCGCGACCCTCCACGCACGCCCGACAAGCCGCAGTGGAACTACCCACCGCCACCAGTCGACATCATGAGCGGAGGAGCCGCCTTCTGGCAGAATTACTCTGAAACTCTGGCGCAAGAGTTAGAGATGGAGCGCAAATCCCGCCAGCAGGCCATGGAGCGCGACGTGAAAAGCCCCCTGTCGGATCGCGCCAGCTACTACAAGAACTCAGTGCTGTTCAGTTCGGCCACTTAG
Protein Sequence: MLGLDGPTNFPLNGSLDVDLCIDEKLTYGPFYPNFVNKVIMYGRVNNIPFDIVANGVDLNEVDKQTTTVDGAKTVLRNIRQNQDLNLILMYQKRLKKERKQRQMIQEQLELELKRRQKVEEALKQSGAPSEILRIVTENLTPSSQETPRSERENGSERESKPPSAEPPSASPPFQRDPPRTPDKPQWNYPPPPVDIMSGGAAFWQNYSETLAQELEMERKSRQQAMERDVKSPLSDRASYYKNSVLFSSAT

Sequence clustering based on sequence similarity using MMseqs2