Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.00069 38 6.1 0.1 21 45 6 30 2 34 0.86

2 7 0.00032 18 7.1 0.1 14 47 28 61 23 64 0.83

3 7 0.00035 19 7.0 0.1 21 46 64 89 59 92 0.87

4 7 0.00015 8.5 8.2 0.1 16 46 88 118 84 122 0.84

5 7 0.00023 13 7.6 0.1 20 46 121 147 116 151 0.85

6 7 0.0017 93 4.8 0.2 16 44 146 174 142 179 0.77

7 7 0.0053 2.9e+02 3.2 0.2 16 32 175 191 171 212 0.73

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.00069	38	6.1	0.1	21	45	6	30	2	34	0.86
2	7	0.00032	18	7.1	0.1	14	47	28	61	23	64	0.83
3	7	0.00035	19	7.0	0.1	21	46	64	89	59	92	0.87
4	7	0.00015	8.5	8.2	0.1	16	46	88	118	84	122	0.84
5	7	0.00023	13	7.6	0.1	20	46	121	147	116	151	0.85
6	7	0.0017	93	4.8	0.2	16	44	146	174	142	179	0.77
7	7	0.0053	2.9e+02	3.2	0.2	16	32	175	191	171	212	0.73

Coding Sequence: NNAACTACTCATGATAAAGAGAAACCTTTCACCTGTCAACTATGTGATTATAGTGCAACACAGAAAGGCCACCTTACTAGACATACTAGAGCTGTACATGATAAAGAGAAACCTTTCACCTGTCAACTATGTGACTATAGTACATCACATAAACACAACCTTACTGCACATATTAAAGCTGTACATGATAAAGAGAAACCTTTCACCTGTCAACTATGTGACTATAGTACATCACAGAAAATCAACCTTACTACACATATTAGAGCTGTACATGATAAAGAGAAACCTTTCACCTGTCAACTATGTGACTATAGTACATCACAGAAAATCAACCTTACTACACATATTAGAGCTGTACATGATAAAGAGAAACCTTTCACCTGTCAACTATGTGACTATAGTACATCACAGAAAATCAACCTTACTACACATATTAGAGCTGTACATGATAAAGAGAAACCTTTTACCTGTCAACTATGTGACTATAGTGCATCACAGAAAGGCAGCCTTACTGCACATATTAGAGCTGTACATGATAAAGAGAAACCTTTCACCTGTCAACTATGTGACTACAGTGCATCATGGAAAATCAGCCTTACTAAACATATTAGAGCTGTACATGATAAAGAGAAACCTTTCATATGTTAA
Protein Sequence: XTTHDKEKPFTCQLCDYSATQKGHLTRHTRAVHDKEKPFTCQLCDYSTSHKHNLTAHIKAVHDKEKPFTCQLCDYSTSQKINLTTHIRAVHDKEKPFTCQLCDYSTSQKINLTTHIRAVHDKEKPFTCQLCDYSTSQKINLTTHIRAVHDKEKPFTCQLCDYSASQKGSLTAHIRAVHDKEKPFTCQLCDYSASWKISLTKHIRAVHDKEKPFIC*

Sequence clustering based on sequence similarity using MMseqs2