Gmel009487.1
Basic Information
- Insect
- Galleria mellonella
- Gene Symbol
- -
- Assembly
- GCA_958496185.1
- Location
- OY292292.1:3708060-3708377[-]
Transcription Factor Domain
- TF Family
- HTH
- Domain
- HTH_psq domain
- PFAM
- PF05225
- TF Group
- Helix-turn-helix
- Description
- This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [1]. In pipsqueak this domain binds to GAGA sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 8.6e-10 5.6e-07 29.6 0.0 3 34 16 47 14 57 0.86 2 2 2.5 1.6e+03 -0.7 0.1 26 35 86 95 84 99 0.84
Sequence Information
- Coding Sequence
- atgCCTCGAAACTATATACGAAAGACTGAATCGAAATACAAAATTGAAGATCTTCGCCATGCAGTTGAAGATGTTAGAAGTAAGAAGCTCACATTAGGCCAAGCTGCTACCAAATATTCAATaccaaaatcaaaattattcaaacaattaaaacaaaacaaagtcaAGACACCAAAAAGAGGTCGATCTGCTGTATTTAATAGAGAACAAGAAGACCAgctagaaaaatatatacttgatTGCTGTAAGACTTTTTATGGAATAACACCAAGTTCATTACGTAGAATTGCTTTTCGATTTGCTGAAGCTAATTCTTAA
- Protein Sequence
- MPRNYIRKTESKYKIEDLRHAVEDVRSKKLTLGQAATKYSIPKSKLFKQLKQNKVKTPKRGRSAVFNREQEDQLEKYILDCCKTFYGITPSSLRRIAFRFAEANS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00387135;
- 90% Identity
- -
- 80% Identity
- -