Gnig013375.1
Basic Information
- Insect
- Galeopsomyia nigrocyanea
- Gene Symbol
- dl
- Assembly
- GCA_035047105.1
- Location
- JAWWMK010004587.1:2384-3660[+]
Transcription Factor Domain
- TF Family
- RHD
- Domain
- RHD domain
- PFAM
- PF00554
- TF Group
- Beta-Scaffold Factors
- Description
- Proteins containing the Rel homology domain (RHD) are eukaryotic transcription factors. The RHD is composed of two structural domains. This is the N-terminal DNA-binding domain that is similar to that found in P53. The C-terminal domain has an immunoglobulin-like fold (See PF16179) that functions as a dimerisation domain [1-2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 0.39 2.3e+03 -0.4 0.4 116 131 58 69 32 78 0.55 2 2 5.6e-22 3.3e-18 67.4 0.1 1 43 81 123 81 125 0.97
Sequence Information
- Coding Sequence
- atGGCAGACTTTCCCATAATGGATAGCGGATCGAGCGCAGTGAACATAAGCGATGTCCTGGAGGCGATCGGTCAAACAGATCCAGAATTCGTTCAGACTGTTCAGGCTCCAGACGTCGAGATGACCCACGAGCCACCGAGACCACAACCTATTGTACAACAACGACAGCAACAGATGCTtgttcaacaacaacaacagcagcaacaacagcagcatcagcaacaACCAAGGCGTGCTTACGTCGAGATTGTCGAACAACCGGCGAGCAAGGCGTTGAGGTTCAGATACGAGTGCGAAGGCAGATCTGCCGGCAGTATTCCCGGCGTCAATAGCACACCGGAGAACAAGACTTTTCCCACTATTCGCGTGAGTGttcgatga
- Protein Sequence
- MADFPIMDSGSSAVNISDVLEAIGQTDPEFVQTVQAPDVEMTHEPPRPQPIVQQRQQQMLVQQQQQQQQQQHQQQPRRAYVEIVEQPASKALRFRYECEGRSAGSIPGVNSTPENKTFPTIRVSVR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -