Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 3.6 3e+03 -1.7 0.0 23 44 18 39 14 48 0.77

2 10 0.0042 3.5 7.7 0.1 22 47 73 98 67 104 0.85

3 10 1.6 1.3e+03 -0.5 0.1 21 47 100 124 96 127 0.65

4 10 0.00076 0.63 10.1 0.1 21 45 128 152 124 156 0.90

5 10 0.0042 3.5 7.7 0.2 21 46 156 181 152 187 0.86

6 10 0.27 2.3e+02 1.9 0.1 21 46 184 209 180 215 0.82

7 10 0.24 2e+02 2.1 0.1 21 46 212 237 207 244 0.82

8 10 0.44 3.6e+02 1.3 0.0 21 46 240 265 236 271 0.83

9 10 0.41 3.4e+02 1.4 0.1 21 46 268 293 264 299 0.82

10 10 0.00021 0.18 11.9 0.0 21 45 296 320 284 322 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	3.6	3e+03	-1.7	0.0	23	44	18	39	14	48	0.77
2	10	0.0042	3.5	7.7	0.1	22	47	73	98	67	104	0.85
3	10	1.6	1.3e+03	-0.5	0.1	21	47	100	124	96	127	0.65
4	10	0.00076	0.63	10.1	0.1	21	45	128	152	124	156	0.90
5	10	0.0042	3.5	7.7	0.2	21	46	156	181	152	187	0.86
6	10	0.27	2.3e+02	1.9	0.1	21	46	184	209	180	215	0.82
7	10	0.24	2e+02	2.1	0.1	21	46	212	237	207	244	0.82
8	10	0.44	3.6e+02	1.3	0.0	21	46	240	265	236	271	0.83
9	10	0.41	3.4e+02	1.4	0.1	21	46	268	293	264	299	0.82
10	10	0.00021	0.18	11.9	0.0	21	45	296	320	284	322	0.87

Coding Sequence: ATGTCCAGCAGTCGAACTTTACATATTCATCAACTCTCCCACAGAGGAAAAaggccttttgagtgtactctGTGCAACAAAAAGTTCTTTACTAAAGGTAACCTGACCGCTCATCTCCTAACtcacacaggggagaagcctTTTAAGTGTACCGAGTGCAACAAGACATTTGTGACGATTGGTCATCGAGATGAGCACCTCCAAACCCACTCAGGAAATAAGCCCTTTGAATGtaccgtgtgcaacaagaagttttcgtGTGGTAGAAATCTGCGTGtccatctccgaacccacacaggagagaagcctttcgagtgtactacgtgcaacaagaagtttgcgAGAAATGAGGACCTGCATGTtcacctccgaacccacactggcgagaagccttttgagtgtactgtgtgcaacaaaaagTTTTCGCAGGCTTGTAATCTGCGTACTCATCTACGAACACATGCAGGGGAAACGCCATTCGAGTGTACCAtttgcaacaagaagttttcgcATAGTAGGTACGTCCGTGtccatctccgaacccacacaggagagaagccctacgagtgtactgtgtgcaacaagaaatgtgTGACGGGTAGCACCCTGCGTGTCCATCtcagaacccacacaggagagaagcctttcgagtgtactgtgtgcaacaagaaatgtgTGACGGGTAGCACCCTGCGTGtccatctccgaacccacactggagagaagcctttcgagtgtactaCGTGCAATAAGAAGTTTGCGAGAAGTGATGAACTGCATGTtcacctccgaacccacactggggagaagcctttcgagtgtactgtgtgcaacaagaaatgtgTGACGGGTGGCACCCTGCGTGtccatctccgaacccacacaggagagaagccctatgAGTGTTCCATTTGCAACAAAAAGTTTTCGCAGGCTGGTAATCTGCGTACTCATCTTCGAACACATACGTAG
Protein Sequence: MSSSRTLHIHQLSHRGKRPFECTLCNKKFFTKGNLTAHLLTHTGEKPFKCTECNKTFVTIGHRDEHLQTHSGNKPFECTVCNKKFSCGRNLRVHLRTHTGEKPFECTTCNKKFARNEDLHVHLRTHTGEKPFECTVCNKKFSQACNLRTHLRTHAGETPFECTICNKKFSHSRYVRVHLRTHTGEKPYECTVCNKKCVTGSTLRVHLRTHTGEKPFECTVCNKKCVTGSTLRVHLRTHTGEKPFECTTCNKKFARSDELHVHLRTHTGEKPFECTVCNKKCVTGGTLRVHLRTHTGEKPYECSICNKKFSQAGNLRTHLRTHT

Sequence clustering based on sequence similarity using MMseqs2