Basic Information

Gene Symbol
-
Assembly
None
Location
ML762988.1:1625718-1632600[-]

Transcription Factor Domain

TF Family
zf-GAGA
Domain
zf-GAGA domain
PFAM
PF09237
TF Group
Zinc-Coordinating Group
Description
Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 8 0.012 10 6.2 0.2 22 45 68 91 56 94 0.89
2 8 5.1 4.2e+03 -2.1 0.0 27 41 109 123 107 129 0.71
3 8 0.3 2.5e+02 1.8 0.0 21 43 130 152 119 158 0.81
4 8 0.047 39 4.4 0.0 21 43 158 180 154 185 0.89
5 8 0.011 8.8 6.4 0.0 21 46 186 211 181 217 0.85
6 8 0.021 17 5.5 0.0 21 44 214 237 210 241 0.90
7 8 0.036 30 4.7 0.0 20 45 241 266 237 270 0.86
8 8 0.042 35 4.5 0.1 21 45 270 294 266 298 0.89

Sequence Information

Coding Sequence
CTGCATCTCGTCCAGCAGCTTTGCTCAACACGATTCGTGAAATCATTCTTCTTGGAGAACAACCTTCGCAGCCCTACTCAAAAAGCCCATAAGCAGGTTAAGTCTGCGTCATCTTGTGAGCGCCTCGTTAGCGCGGCGCTCGAAGAACCCAcgagtgcgccgtgtgcaaAAAGAATGTTGAACTCGCACCTCAACTCAAGAAAGGAACCTATTAGGTGCGTCGTGTGCCACAAGTTGTTCTCCCATTCATCTTACCTCCGCACCCATTTGCAAACTCATACTGGTGAAAATGTGCGAACGCGCCCAGTAGCGAAACTATTCGACTGCAGCGTGTGCCACAAGatgttttccgaatcatctAAAGTCCGTCACATGCGCACTCatactggtgaaaaaccatttgagtgcaccgtTTGCCACAAGACGTTTGCCGTGTCTGGCGATTTGAATATTCATTTtagaacgcacacaggagagaaaccattcgagtgcgACGTGTGCCACAAGTTGTTTACCCAATTAGCTCATCTCCGTATTCACACGCGtactcacactggtgaaaaaccatatgagtgtactgtgtgcaacaagatgTTGACCAACTCTTCCGCTTTGAAGATTCATTtgcgaacgcacacaggagagaaaccatttgagtgcgaCGTGTGCCACAAGTTGTTTGCCCAATTATCTGGTCTCCGTGCTCATATGCGAAGTCATAATGGTgaaaaaccattcgagtgcactgtgtgccacaagacgGTGACCAGTCATGCCTCTTTGAAGAGTCATTtgcgaacgcacacaggagagaaaccatttgagtgcaacGTGTGCCACAAGTTGTTTGCCCACTTATCTGCTCTTCGCAAACACATGCGAACTCATAAAGGAAGAAAATGA
Protein Sequence
LHLVQQLCSTRFVKSFFLENNLRSPTQKAHKQVKSASSCERLVSAALEEPTSAPCAKRMLNSHLNSRKEPIRCVVCHKLFSHSSYLRTHLQTHTGENVRTRPVAKLFDCSVCHKMFSESSKVRHMRTHTGEKPFECTVCHKTFAVSGDLNIHFRTHTGEKPFECDVCHKLFTQLAHLRIHTRTHTGEKPYECTVCNKMLTNSSALKIHLRTHTGEKPFECDVCHKLFAQLSGLRAHMRSHNGEKPFECTVCHKTVTSHASLKSHLRTHTGEKPFECNVCHKLFAHLSALRKHMRTHKGRK

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00733403;
90% Identity
iTF_00733403;
80% Identity
iTF_00733403;